KEGG   Thermoanaerobacter sp. X513: Thet_0084Help
Entry
Thet_0084         CDS       T01317                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
thx00010  Glycolysis / Gluconeogenesis
thx00052  Galactose metabolism
thx00500  Starch and sucrose metabolism
thx00520  Amino sugar and nucleotide sugar metabolism
thx00521  Streptomycin biosynthesis
thx01100  Metabolic pathways
thx01110  Biosynthesis of secondary metabolites
thx01120  Microbial metabolism in diverse environments
thx01130  Biosynthesis of antibiotics
thx01200  Carbon metabolism
Module
thx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:thx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thet_0084
   00052 Galactose metabolism
    Thet_0084
   00500 Starch and sucrose metabolism
    Thet_0084
   00520 Amino sugar and nucleotide sugar metabolism
    Thet_0084
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Thet_0084
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Thet_0084
Enzymes [BR:thx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Thet_0084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: ADN53753
Position
93466..94413
Genome map
AA seq 315 aa AA seqDB search
MGRILCGVDLGGTKISTGLVDEKGNIIRSTKIPTMAEKGPEEVIKRIEQSVYDVLKEAGL
KLSDLKGVGIGSPGPLDAKRGVVISPPNLPGWDNVPIVDILSHKLGVKVKLENDANAAAI
GEHLFGAGKGIDNFVYITVSTGIGGGVIIEGKLYSGENSNAAEIGHHTINFNGPRCNCGN
YGCFEAFASGTAIARFAQEGIQNGKDTMIRDLAKDGVVKSEHVFEAAKLGDEFAKELVDN
EAFYLGVGISNIMAFYNPKKIAIGGGVSTQWDMLYDKMMETIKKKALKPNAEVCEVVRAE
LGENVGVLGAAALLL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggggagaatcctatgcggtgttgacttaggagggacaaagataagcacaggactcgtg
gatgagaagggcaatatcataagaagcacaaaaatacctactatggctgaaaaagggcca
gaagaagtgattaagcgaatagaacaaagtgtttatgacgttttaaaagaagcaggatta
aaattatctgatttaaaaggagttgggattggatctccagggccccttgatgccaaaagg
ggggtagttataagcccacctaatcttccgggttgggacaatgtccctattgtggatatt
ttatctcataagctgggagttaaagtaaaattagagaatgatgcaaatgctgcagctatt
ggagaacatttatttggcgcaggaaaaggtatagacaattttgtttatataactgtaagt
actgggattggcggtggcgtgataatagaagggaaactttatagcggagaaaattctaat
gcagctgagattgggcaccatactataaattttaatggacctcggtgtaattgcggaaat
tatggatgttttgaggcttttgcttctggtacagctattgcgagatttgctcaagaggga
attcaaaatgggaaagatacaatgataagggatttagctaaggatggagtagtaaaatca
gaacatgtatttgaagcggcaaaattgggagatgagtttgcgaaagaattggttgacaat
gaagctttttatcttggagtgggaatttcaaatatcatggctttttataatccaaaaaaa
attgccataggtggtggcgtatccactcaatgggatatgctttatgataaaatgatggaa
acaataaagaaaaaagcattgaagcctaatgccgaggtttgtgaggtagtaagagctgaa
ttaggagaaaacgtgggagttttaggagcggcagcattactcttataa

DBGET integrated database retrieval system