KEGG   Thermoanaerobacter sp. X513: Thet_0313Help
Entry
Thet_0313         CDS       T01317                                 

Definition
(GenBank) Mannitol dehydrogenase domain protein
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
thx00051  Fructose and mannose metabolism
thx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Thet_0313
Enzymes [BR:thx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     Thet_0313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N 3HCDH_N ApbA Sacchrp_dh_NADP NAD_Gly3P_dh_N TSNR_N
Motif
Other DBs
NCBI-ProteinID: ADN53974
Position
327788..328954
Genome map
AA seq 388 aa AA seqDB search
MLKAVHFGAGNIGRGFIGYLLYKSGYEITFVDISKELVESINNYKRYNVIILKDNVEKEE
VKNIKAIHIEDEENLSKAIVDADIVTTSVGANNLKSIGEKLINYLKIRKANIDKPLNIMA
CENALFATNILKNSILEKGDRDFIEYVNQKIGFPNTAVDRIVPNVDIKKELPIDVAVEDF
YEWDIEKKAIIGDLNIRGAELVDDLEPYIERKLFLLNGAHATTAYLGYLKGYKYIHEAIE
DDFIRNIVSRMQEEASLALSRKHNIKKDDLERYASKVIKRFKNPYLKDEVVRVGREPTRK
LSVNDRLMMPAKLCYEIGITPEFILYGIAAGFLFDYKEDPQACKIQDDIKNFGLEKTISK
VTGLEENSDLLQEIVKKYKELKETFRKR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaagcggttcattttggagcagggaatataggcagaggatttatagggtatttg
ctttataaatctggatatgaaataacttttgttgatatatcaaaagaattagtagaaagc
ataaataattataaaagatataatgtgattattttaaaagataatgtggaaaaagaagaa
gtaaaaaatatcaaagctattcatatcgaggatgaagaaaatctatccaaggctattgta
gatgcagatatagttacgacttcagtaggagctaataatcttaagagcataggggaaaag
ttgataaattatttaaagataagaaaagctaacattgataaacctttgaatataatggca
tgtgaaaatgcactgtttgcaacaaatatactaaaaaatagtatattggaaaaaggtgat
agagattttattgagtacgtaaatcaaaaaattggttttcctaatacggctgtggacaga
atagtaccgaatgtagatataaagaaagaactgccaatagatgtagcagtggaagatttt
tatgaatgggatattgagaaaaaagcaattattggggatttaaatatcagaggggcggaa
cttgtcgatgaccttgaaccttatatagaaagaaaattatttttattaaatggagcccat
gctaccactgcatatttaggatatttaaaagggtataaatatatacatgaagcgattgag
gacgattttataagaaatatagtgtctaggatgcaagaagaagcttctcttgcgctttct
agaaagcacaatataaaaaaagatgatttagagaggtatgcaagtaaggtaataaaaagg
tttaaaaacccctatttaaaagacgaagttgtaagagtaggaagagagcctacaaggaaa
ttgtctgtaaatgaccggttaatgatgcctgccaaactttgttatgaaattggaattacg
cctgaatttatactatatggtatagctgcagggtttttgtttgattataaggaagaccct
caagcttgtaaaattcaagatgacattaaaaatttcggcttagaaaaaacaataagcaaa
gttacaggtttagaagaaaatagtgatttattgcaagaaattgtaaagaagtataaagaa
ttgaaagaaacttttagaaaaagatga

DBGET integrated database retrieval system