KEGG   Thermoanaerobacter sp. X513: Thet_0697Help
Entry
Thet_0697         CDS       T01317                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
thx00040  Pentose and glucuronate interconversions
thx00052  Galactose metabolism
thx00500  Starch and sucrose metabolism
thx00520  Amino sugar and nucleotide sugar metabolism
thx01100  Metabolic pathways
thx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:thx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Thet_0697
   00052 Galactose metabolism
    Thet_0697
   00500 Starch and sucrose metabolism
    Thet_0697
   00520 Amino sugar and nucleotide sugar metabolism
    Thet_0697
Enzymes [BR:thx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Thet_0697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ADN54331
Position
714198..715106
Genome map
AA seq 302 aa AA seqDB search
MKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAIQSGIEDILIITGRNK
RAIEDHFDKSVELELELKKKNKESLLNLVEDISNMVNIHYIRQKEPKGLGHAIYCAKSFV
GNEPFAVLLGDDIVDSEVPVLKQMIDQYERYNCSIIGVQEVPYEDVDKYGIVDAAIIEDR
LYKVKDLVEKPKKEKAPSNIAILGRYIITPRIFEILENTPPGAGGEIQLTDALKTLLNYE
AIYAYNFIGKRYDVGDKLGYLMATVEYALKREDLSEPFKRYLLELVDNLTAIEKEAAVTK
VK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaataagaaaggcgataattccggctgcaggccttggtacgaggtttttgcctgct
accaaggctcagcctaaagaaatgcttccaattgtggacaaacccactattcaatatata
gtcgaagaggcgattcaatcgggaattgaggatatccttataataactggcagaaataaa
agagcaatagaagaccattttgataaatctgtggagttggagctggagttaaaaaagaaa
aacaaggaaagtttacttaaccttgtagaggatattagcaatatggtgaacattcactat
ataaggcaaaaggaacctaaagggttgggacatgctatttactgtgctaaatcttttgta
ggaaatgagccttttgcagtacttttaggagatgacatagtagattcagaagtgccggtt
ttaaagcagatgattgaccaatacgaaaggtacaactgttctattattggggtacaagag
gtgccgtatgaggatgtagataaatatggaatagttgacgctgctattattgaggataga
ttatacaaagtcaaagaccttgtggaaaagcctaaaaaagaaaaggcgccttctaacatc
gctattttgggaagatatataattacaccaagaatatttgaaatattggaaaacacgcca
ccaggagcaggaggtgaaatacagcttacagatgctttaaaaactctcttaaattatgaa
gcaatttacgcctataattttattggcaagagatatgatgtgggagataaattaggttac
cttatggcaactgttgagtatgctctaaaaagagaggacttaagtgaaccttttaagagg
tatttattagaacttgttgacaatttaacagctatcgaaaaggaggctgcggttacaaaa
gtaaaatag

DBGET integrated database retrieval system