KEGG   Thermoanaerobacter sp. X513: Thet_0926Help
Entry
Thet_0926         CDS       T01317                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine/D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
thx00471  D-Glutamine and D-glutamate metabolism
thx00550  Peptidoglycan biosynthesis
thx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Thet_0926
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Thet_0926
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:thx01011]
    Thet_0926
Enzymes [BR:thx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     Thet_0926
Peptidoglycan biosynthesis and degradation proteins [BR:thx01011]
 Precursor biosynthesis
  Amino acid ligase
   Thet_0926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C 2-Hacid_dh_C AlaDh_PNT_C NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ADN54551
Position
933710..935074
Genome map
AA seq 454 aa AA seqDB search
MELKGKKVLVAGLGVSGIALCKVLDSLKAKVIAYDEKEYDVLKENLEEIKSLSIDFRFGK
FKKEFLEGVDLIVLSPGVPIDSDIVKTAQEKKIELLGEVEFAYRFSKAPIYAITGTNGKT
TTTSLLGEMFKNTGRKVYVAGNIGYPLIYAVMEAAEDDFIVAEISSFQLETIKEFKPKIS
CIINITPDHLDRHKTFENYRDIKGRIFENQREDEYTVLNYDDPVTWSLKNKAKCRVFPFS
RKSLLENGAYIKDGSIYISVNGNAEKIIDIEEIYIPGEHNLENALAASSVAYLSGISADV
IANTLKTFKGVEHRIEFVDEINGVKFYNDSKGTNPDASIKAIQALKTPIVLIAGGYDKGS
EFDEFVKAFNGKVKKLILIGQTAKKIRDTARKYSYPEDDILFAGTLEEAVKKAYESAKEG
DSVLLSPACASWDMFRNFEERGRIFKKAVAELRR
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggaactaaagggtaaaaaagttcttgtggcaggtttaggagttagcggaatagctttg
tgtaaagtgttggacagcttgaaggcgaaagtaatagcttatgatgaaaaagaatatgat
gtattaaaagaaaatttagaagaaattaaaagtttgtccatagattttaggtttggtaaa
ttcaaaaaggaatttttagaaggtgtggatttgattgttttaagtccaggtgttcctatt
gattcggatatagtaaaaacagcacaagaaaagaaaattgaattattgggagaagtggag
tttgcatataggttttctaaagctcctatttatgcaattacaggtacaaatggcaagaca
actactacttctttattaggagaaatgtttaaaaatacggggagaaaagtatatgttgct
gggaatattggttatccacttatttatgctgtcatggaagcggcagaagatgattttatc
gtagcagagattagtagctttcaattagagactataaaagagtttaaacctaaaataagc
tgtataataaatattactcctgatcatttagacagacataaaacctttgaaaattatagg
gatataaaaggaagaatttttgaaaatcaacgagaagatgaatatactgttctcaattac
gatgaccctgttacttggagtctaaaaaataaggctaaatgcagagtttttccttttagt
agaaaaagtttattagaaaatggggcatatataaaagatggaagtatttatataagtgtt
aatggaaatgctgaaaaaattattgacatagaggaaatttatattcctggagaacacaat
ttagagaatgcattggccgcttcttcagtagcatatctttcagggattagtgcagatgtt
attgcaaatactttaaagacttttaaaggtgtagaacataggattgagtttgttgatgaa
ataaatggtgtaaaattttataacgattctaaagggactaacccagacgcttcaattaaa
gcaatacaggccttaaaaacccctatagttttaattgctggtggttatgataaaggtagt
gaatttgatgagtttgtaaaagcctttaatgggaaagtaaagaaattgattttgataggg
caaactgcaaaaaaaatcagagatactgcaaggaagtattcttatcctgaagatgacata
ctttttgctggtaccttagaagaagctgttaaaaaagcttatgaaagtgcgaaagaggga
gatagtgtacttttatcaccagcttgtgccagttgggatatgtttaggaattttgaggag
aggggaagaatctttaaaaaggcagtggcagagttgaggaggtaa

DBGET integrated database retrieval system