KEGG   Thermoanaerobacter sp. X513: Thet_1139Help
Entry
Thet_1139         CDS       T01317                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
thx00230  Purine metabolism
thx01100  Metabolic pathways
Module
thx_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:thx00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Thet_1139
Enzymes [BR:thx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Thet_1139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 Thymidylate_kin AAA_33 ABC_tran dNK MMR_HSR1 AAA_28 Cytidylate_kin RsgA_GTPase ADK AAA_17 AAA Rad17 AAA_22 AAA_29 cobW PPK2 RNA_helicase T2SSE AAA_16 TsaE APS_kinase Zeta_toxin
Motif
Other DBs
NCBI-ProteinID: ADN54742
Position
1148189..1148812
Genome map
AA seq 207 aa AA seqDB search
MLSKKKKGLLIVLSGPSGAGKGTICKALMEKEKDLKLSISATTRQPRSGEIEGKNYFFKS
EEEFEKMIENDSFLEWAKVYGHYYGTPKDFVLKNLDEGNDVVLEIDIQGALKIKEKFPEG
VFIFILPPSMEELKNRIKKRGTETEEEIIKRFKSAYEELNYVSRYNYVVINDSVEEAVEK
IKAIIIAEKCRVDRNKDLYLEIKEGLV
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtgttgtcgaaaaagaaaaaagggttacttattgtactttctgggccttcaggggcagga
aaagggacgatatgcaaagctttgatggaaaaagagaaagatttaaaattgagtatatct
gctactacccgtcagccaagaagcggagaaatagaagggaaaaactatttttttaaatcg
gaagaggaatttgagaaaatgatagaaaatgattcttttttagaatgggcaaaggtatat
ggccactactacggtacaccgaaggatttcgtattaaaaaatttagatgaaggaaatgat
gtggttttagagatagatattcaaggagctttaaaaataaaagagaagtttccagaagga
gtgtttattttcatattgcctccttcaatggaagaattaaaaaataggattaaaaaacgg
gggacagagacagaagaggagataataaaaagatttaaaagtgcttatgaggaattaaac
tatgtttccaggtacaattatgtagttataaatgatagtgtagaagaagcggttgaaaaa
attaaagctataattattgcagagaaatgcagagttgatagaaataaggatttgtactta
gaaatcaaggaggggttggtatga

DBGET integrated database retrieval system