KEGG   Thermoanaerobacter sp. X513: Thet_1320Help
Entry
Thet_1320         CDS       T01317                                 

Definition
(GenBank) Conserved carboxylase region
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
thx00620  Pyruvate metabolism
thx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Thet_1320
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:thx02000]
    Thet_1320
Enzymes [BR:thx01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Thet_1320
Transporters [BR:thx02000]
 Other transporters
  Primary active transporters [TC:3]
   Thet_1320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like TGT
Motif
Other DBs
NCBI-ProteinID: ADN54920
Position
complement(1311500..1312897)
Genome map
AA seq 465 aa AA seqDB search
MSNKIKITETVLRDAHQSLLATRMSTEEMLPIAEKLDAVGYYSIEAWGGATFDACMRFLD
EDPWERLRRLKKRIKNTPLQMLLRGQNLLGYRHYPDDIVEKFVERAVANGIDIIRIFDAL
NDVRNLEVAVKATKKAGAHAQGTLVYTISPVHNIDHYIKVAKELTELGVDSICIKDMSGI
LTPYVAYELVKSLKDAVNIPIQLHSHYTSGMAAMTYLKAIEAGVDIIDTAISPLALGTSQ
PATETMVAILKGTQYDTGLDMELLSEIASYFKEVKQNHSKEIDLSMVMGVDTDVLIYQVP
GGMLSNLISQLKQQNVLDKYPEVLKEIPKVREELGYPPLVTPMSQMVGTQAVLNVITGER
YKMVPKEVKDYVKGLYGRPPAPISEEIKKKIIGDEEVIDIRPADLLKPQFEAIKEEIKEY
YEQEEDVLSYALFPQVAKKFFEYRRAKKYQIDATLLNMEYMTYPV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagtaataaaattaaaattacagaaactgtattaagagatgcccatcagtcactcttg
gctactcgaatgtcgacggaagaaatgctcccaattgcagaaaaattggatgcagtagga
tattattctattgaagcgtggggaggagctacctttgatgcttgtatgagatttcttgac
gaagacccttgggaaagattgagaagattaaagaagaggataaaaaatacccctcttcaa
atgcttttgagaggacaaaatctattaggatataggcattatcctgatgatatagtagaa
aaatttgttgagagggctgttgctaacggaatagatataataagaatttttgatgcttta
aatgatgtacgaaatcttgaagttgccgttaaagctactaaaaaagcgggagcccacgct
caaggtacccttgtttatactataagtcctgttcacaacattgaccattatattaaagta
gcaaaagagctgacagaattaggagtggattccatatgcataaaggatatgtcaggaata
ttaactccttatgttgcttatgagttagtaaaaagccttaaagatgcagtaaatattcct
atacagttgcacagccattatacgagtggaatggcggctatgacttatcttaaagcaata
gaggctggagtagatataatagacactgctatttcacctttggcattaggaacttctcaa
cctgctacagaaacaatggtagctattttaaaaggcactcaatatgacactggtttggat
atggagttattatcagaaattgcttcatactttaaagaagtaaaacaaaatcacagtaaa
gaaatagatttatctatggttatgggcgtagatacagatgtattaatttatcaagttcca
ggaggaatgctatcaaatttaatttcccaattaaaacaacaaaatgttttagataagtac
ccagaggttttaaaagaaattcctaaagttagagaagaattaggatacccacctcttgtt
actcctatgagtcagatggtagggactcaagctgtcttgaatgtaataactggagaaagg
tataaaatggtaccaaaagaagtaaaagattatgtgaaaggactgtatggtagaccacca
gcgccaatttcagaagaaataaagaaaaaaataataggagatgaagaggtaatagatatt
agaccagcagaccttttaaaaccgcaatttgaagcgattaaagaagaaattaaagagtat
tatgaacaagaagaagatgttttatcttatgctcttttcccacaagtagcaaagaagttt
tttgaatacagaagagcaaaaaaatatcaaatagatgcaactcttcttaatatggaatat
atgacatatccagtttaa

DBGET integrated database retrieval system