KEGG   Thermoanaerobacter sp. X513: Thet_1422
Entry
Thet_1422         CDS       T01317                                 

Definition
(GenBank) cobalamin B12-binding domain protein
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
thx00472  D-Arginine and D-ornithine metabolism
thx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Thet_1422
Enzymes [BR:thx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Thet_1422
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: ADN55021
Position
complement(1398705..1400909)
AA seq 734 aa
MKLEKDKKIDIEEILKDLDKYVPRRRGWHWREDVGKHKIGDFEYYQVSKPLKNSIPLPAA
KHFGNIDPQPDCVITTEIASGRFEDDIRRMRMAAWHGADHIMVIRTLGQSHFDGLIEGTP
EGVGGVPISRKQIRATRKALDLIEDEVGRPINFHSYVSGIAGPEVAVMFAEEGVNGAHQD
PQYNVLYRNINMVRSFVDAAVAKKIMADANILQIDGAHNANATAKYGWKVMPELLVQHAI
NTLYSRKVGMKPENIALSTVPPNAPPTPSIRLDLPYAVALRQLFKDYKMRAQMNTKYIEH
DTREATVTHVLNLLISRLTSADIQSTITPDEGRNVPWHYNNINAINTAKQALIGMDGLKE
MVKLNFDGELGKKVRELKMRAILFMEEILEVGGYFKAVEEGFFVDSGYYPERNGDGIVRT
INGGIGAGTVYKRDKDYMAPVCSHFGYNNLPEGLNKPCDLINGCTLCKHEKIQYIDELDE
SDNVENRLKETVEYRKGDKIKPEVEWAGDGIISMNLFLPVDERTAEYAAIKYAEKLGLND
VVVLGKLPMHPAEGTYVEVRGRVQFSIDKNELEIPPQEEILSDEEIEGDIKRKPMKVVAA
TVGNDEHSVGLREILDIKHGGIEKYGIKFTYLGTSCPAEKLVDAAIEENADAILVSTIIT
HDDVHIKNMKKIHDFCVEKGIRDKVILVGGGTQITIDLAKSVGFDAGFGRGTKGNQVASF
LVKKRREKENEENN
NT seq 2205 nt   +upstreamnt  +downstreamnt
atgaagcttgaaaaggataaaaaaatagatattgaagagattttaaaagatttagataaa
tatgtgccgaggagaagaggatggcactggagagaggatgtaggcaaacacaaaattggc
gattttgagtattatcaggtttcaaaaccacttaaaaacagtattccacttcctgctgca
aaacactttggaaacattgatcctcagccagattgtgtgataactacagaaatagcttca
ggaaggtttgaagatgatataaggcgcatgaggatggcagcatggcatggagcagaccac
ataatggtaatcagaactttaggacaaagtcattttgatggacttattgaaggaacacct
gagggtgtaggaggagttcctatttcgagaaaacaaataagagcgacgagaaaagcattg
gatttaattgaagatgaagtcggtaggcctataaactttcactcttatgtaagtggaata
gctggacctgaagtagctgttatgttcgctgaagaaggggtaaatggtgcccatcaagac
cctcagtacaatgtcctttatagaaatataaacatggtaaggtcttttgtagatgcagca
gttgctaagaaaataatggcagatgctaatatacttcaaattgatggtgctcataacgcc
aatgcaacagcaaaatatggatggaaagttatgcctgaacttttagtacagcatgccata
aatacactttattcgagaaaagtaggaatgaaaccagaaaacatagccttatctacagtg
ccaccaaatgctccaccaactccttctatacgtttggatttgccttatgcagtggcttta
agacaactttttaaagattataaaatgagggcacagatgaacacaaaatatattgagcac
gatacaagagaagcaactgtgacacatgtgcttaaccttttaatatctcgattgacatct
gcagacatacaaagtactattactcctgatgagggaagaaatgtaccatggcattacaac
aatataaacgcgataaacactgctaaacaagcccttataggcatggatggccttaaagag
atggtaaaactcaattttgatggagagttaggcaaaaaagtaagagaattaaagatgaga
gccattctctttatggaagaaattttagaagttggaggatactttaaggcagtagaagaa
ggtttctttgtggattcaggctattatccagagagaaatggagatggcatagtaagaact
ataaatggtggtattggcgccggtactgtttacaaaagagataaagactatatggcgccg
gtatgctctcactttggatataacaatttgccagaagggcttaataaaccttgcgattta
ataaatggatgtactctttgcaagcatgagaaaattcaatatatagacgaattagatgaa
agtgacaatgtagaaaatagattgaaagaaactgttgagtatagaaaaggagataaaata
aaaccagaagtggagtgggcaggagacggcataataagcatgaacctatttttgcctgta
gatgaaaggactgctgaatacgcggctattaaatacgcagaaaagctggggcttaatgat
gtagtcgttttaggtaaacttccaatgcatcctgcagagggaacgtacgtggaagtaaga
ggacgtgttcaattttctattgacaaaaatgaattagaaataccgccgcaagaggaaata
ctttcagatgaggaaatagaaggagatatcaagagaaagcctatgaaggtggttgctgca
actgtaggaaatgatgaacattctgtgggcttaagagagattttggatataaaacacggc
ggaattgaaaaatacggcataaaatttacttaccttggtacttcttgccctgcagaaaag
ttagttgatgcagctatagaggaaaatgctgatgctattttagttagcactataataacc
catgatgatgtccatataaagaatatgaaaaaaattcacgacttttgtgtagaaaaggga
ataagagataaagtaattttagtaggtggaggtacgcaaattacaatcgaccttgctaaa
agtgttggctttgatgcaggatttggaaggggtacaaaaggaaatcaagtggcaagtttt
ttagttaaaaaaagaagggaaaaggaaaatgaagaaaacaattga

DBGET integrated database retrieval system