KEGG   Thermoanaerobacter sp. X513: Thet_1598Help
Entry
Thet_1598         CDS       T01317                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
thx00010  Glycolysis / Gluconeogenesis
thx00051  Fructose and mannose metabolism
thx00562  Inositol phosphate metabolism
thx01100  Metabolic pathways
thx01110  Biosynthesis of secondary metabolites
thx01120  Microbial metabolism in diverse environments
thx01130  Biosynthesis of antibiotics
thx01200  Carbon metabolism
thx01230  Biosynthesis of amino acids
Module
thx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
thx_M00002  Glycolysis, core module involving three-carbon compounds
thx_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:thx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thet_1598
   00051 Fructose and mannose metabolism
    Thet_1598
   00562 Inositol phosphate metabolism
    Thet_1598
Enzymes [BR:thx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Thet_1598
Exosome [BR:thx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Thet_1598
  Exosomal proteins of bladder cancer cells
   Thet_1598
  Exosomal proteins of melanoma cells
   Thet_1598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADN55185
Position
complement(1568557..1569327)
Genome map
AA seq 256 aa AA seqDB search
MTSKGVFVLRRPIIAGNWKMHMTPSEAVKLVDELIPQVKDAKAEVVVIPPFVDLTEVNKV
IQGTNILLGAQDMFWEEKGAYTGEISPLMLKEIGVKYVVIGHSERRQYFGETDEMVNKKV
LSALSHGLSPIVCVGESFSQREEGKTFEVVLSQTKEALKGVTHDDIVNVVIAYEPIWAIG
TGKTATAKDANEVIKAIRNTIASLYGKEKADLVRIQYGGSVKPENISELMAESDIDGALV
GGASLVASDFAKIVNY
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtaaaggggtgtttgttttgagaagaccaataattgcaggtaattggaaaatg
cacatgaccccttctgaagcggtgaaattagttgatgaattgatacctcaagtgaaagac
gcaaaagcagaagtggtagtcatacctccctttgtggatttgacagaggtaaataaagta
attcaaggtactaatattcttctcggagcacaagatatgttttgggaagaaaagggcgca
tatacgggggaaatttcacctttaatgcttaaagagattggggtaaaatatgttgtaata
ggccactctgaaagaaggcagtattttggtgagacggatgaaatggtcaataaaaaagtt
ttatccgctctatctcacggcttaagtcctattgtgtgtgtaggagaatctttttctcaa
agagaagaaggaaaaacttttgaagtagttttaagtcaaactaaagaggctttaaaaggc
gttacccacgatgatattgtaaatgtagtaatagcttatgagccaatttgggctataggt
actggcaaaacggctacagctaaagacgccaatgaagtgataaaagctataagaaatact
atagcttccctttatggaaaagaaaaagcagatctggttagaatacaatatggggggagt
gtaaagcccgagaacatctctgaactcatggcagagagcgatatagacggggctttagtg
gggggagcaagtcttgtagcatcagattttgcaaagattgtcaattattaa

DBGET integrated database retrieval system