KEGG   Thermoanaerobacter sp. X513: Thet_2359Help
Entry
Thet_2359         CDS       T01317                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
thx  Thermoanaerobacter sp. X513
Pathway
thx00260  Glycine, serine and threonine metabolism
thx00750  Vitamin B6 metabolism
thx01100  Metabolic pathways
thx01110  Biosynthesis of secondary metabolites
thx01120  Microbial metabolism in diverse environments
thx01230  Biosynthesis of amino acids
Module
thx_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:thx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thet_2359
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Thet_2359
Enzymes [BR:thx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Thet_2359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Peripla_BP_6 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ADN55909
Position
complement(2330294..2331349)
Genome map
AA seq 351 aa AA seqDB search
MGWEGLIKAYREFMPKIKEENIVTLKEGNTPLYEAVNLQKLFPGIKIYLKYEGLNPTGSF
KDRGMTVAVSQAKEEGSNAVVCASTGNTSASAAAYAAKAGLKSIVLIPGGKIALGKLAQA
IAYGAKVIAIDGNFDDALRLVREISQKFPITLVNSINPYRLEGQKTASFEICDELKDAPS
YVALPVGNAGNITAYWMGFKEYYNAKRITRLPKMLGFQAAGAAPIVENRVIEKPETIATA
IRIGNPASWEKAVAARDESGGLIDKVTDEEILEAYALLAKSEGIFAEPASAASIAGVIKK
YKEGFFKEGESVVCVLTGNGLKDPDTAVKLGGEIKTIEANLKALEEVLYGE
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggatgggaaggtctaataaaagcttatagagaatttatgcctaaaataaaagaggaa
aacatagttacattaaaagaaggcaatacacctctttatgaggctgtaaatcttcaaaag
ctttttccaggcataaaaatatatctgaaatacgaaggattaaacccaacaggttctttt
aaagacagggggatgactgtagcagtgtcgcaggcaaaagaagaaggttctaatgcagtt
gtgtgtgcttcaacaggaaacacttctgcttctgcagctgcctatgcagcaaaggcagga
cttaagagcattgtacttatacccggcggcaaaattgctttaggaaagcttgctcaagcc
attgcttatggtgctaaagtcattgctatagatggaaactttgatgatgctttaagatta
gtcagagaaatttcacaaaaattccctataacgctggttaattccataaatccatatagg
ttggaaggacaaaagacagcttcttttgaaatatgtgacgaacttaaagatgctccttct
tatgttgcgcttcctgtgggaaatgcggggaatataacagcctattggatgggatttaaa
gaatattataatgcaaaaagaataacgaggcttcctaaaatgttaggttttcaggcagct
ggagctgcacctatagttgaaaacagagtaattgaaaaacctgagactattgcaacagcg
atacgaataggtaatccagccagctgggaaaaggcagttgctgcaagagatgagtcaggt
ggactcattgacaaagtcacagatgaagaaatactggaggcttatgcgcttttagctaag
agcgaaggaatttttgcagagcctgcttcagcagcttctattgcaggagttattaaaaaa
tacaaggaaggattttttaaagaaggagaatctgttgtttgtgtcttgacgggaaatgga
ttaaaagatccagatactgctgttaaattaggtggcgagataaaaacgatagaggcgaat
ctaaaagcattggaggaagttttatatggagagtga

DBGET integrated database retrieval system