KEGG   Thermococcus sp. P6: A3L12_04355Help
Entry
A3L12_04355       CDS       T05739                                 

Definition
(GenBank) fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
thy  Thermococcus sp. P6
Pathway
thy00051  Fructose and mannose metabolism
thy01100  Metabolic pathways
thy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:thy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    A3L12_04355
Enzymes [BR:thy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     A3L12_04355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II Peptidase_M85
Motif
Other DBs
NCBI-ProteinID: ASJ10581
UniProt: A0A218PCJ1
Position
810520..811080
Genome map
AA seq 186 aa AA seqDB search
MSRIAKSQLIHYSRKAHERGLTAAFGGNLSLLFGGLVFIKSTGAVMDELNAGDIAVIDLD
GRQVSGVRPSSEYRMHLAIYREREDVRAVVHLHPPYSIAASTMAGKELPIITPEAELYLG
RIPVAEFRPAGTRELAEKVAEAIKESDAVIMERHGIVTVGRTLREAFYRAELVEESAKLW
YLAERR
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgagtcggattgcgaagtcccagctgatccactactcaagaaaagcccacgaacggggc
cttaccgcggccttcggcggaaacctcagtctcctgttcggagggctggttttcataaaa
tccacgggggcggtgatggacgagctcaacgccggcgatatcgcggtgatagacctcgat
ggaaggcaggtctcaggggtcaggccctcctccgagtacaggatgcatctggccatctac
agggagagggaagacgttagagccgtggtccacctccatccgccctactcgatagccgca
tccacgatggccggaaaagaactgcccataataacgccggaagccgagctctaccttgga
aggattcccgtggcggagttccggcccgccggaacacgggagcttgcggagaaggtggcg
gaagcgatcaaggaatcggacgctgtgataatggagcgtcacggcatagtcaccgtcgga
agaaccctgagggaggccttctacagggcggaactcgtggaggagagcgcaaaattatgg
tacctggcggaaaggcgttga

DBGET integrated database retrieval system