KEGG   Thermotoga sp. Cell2: CELL2_03385Help
Entry
CELL2_03385       CDS       T03495                                 

Definition
(GenBank) acetate kinase A/propionate kinase 2
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
thz  Thermotoga sp. Cell2
Pathway
thz00430  Taurine and hypotaurine metabolism
thz00620  Pyruvate metabolism
thz00640  Propanoate metabolism
thz00680  Methane metabolism
thz01100  Metabolic pathways
thz01120  Microbial metabolism in diverse environments
thz01200  Carbon metabolism
Module
thz_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:thz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CELL2_03385
   00640 Propanoate metabolism
    CELL2_03385
  09102 Energy metabolism
   00680 Methane metabolism
    CELL2_03385
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    CELL2_03385
Enzymes [BR:thz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     CELL2_03385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase ROK
Motif
Other DBs
NCBI-ProteinID: AIY87987
Position
complement(639942..641153)
Genome map
AA seq 403 aa AA seqDB search
MKVLVINSGSSSIKYQLIEMDGEKVLCKGIAERIGIEGSRLVHRVNDEKYVIERELPDHE
EALKLILNTLVDEKLGVIKDLKEIDAVGHRVVHGGERFKESVLVDEEVLKAIEEVSPLAP
LHNPANLMGIKAAMKLLPGVPNVVVFDTAFHQTIPQKAYLYAIPYEYYEKHRIRRYGFHG
TSHRYVSKRAAEILGKKLEELKIITCHIGNGASVAAVKYGKCVDTSMGFTPLEGLVMGTR
SGDLDPAIPFFIMEKEGISPQEMYDILNKKSGVYGLSKGFSSDMRDIEEAALKGDEWCKL
ILDIYHYRIAKYIGAYAAAMNGVDAIVFTAGVGENSPITREDVCSYLEFLGVKLDKQKNE
ETIRGKEGIISTLDSRVKVLVVPTNEELMIARDTKEIVEKIGR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtactggtgataaactcgggaagttcctcaataaagtaccagctcatcgagatg
gacggtgagaaagttctttgtaagggtatcgcagaaagaatcggcattgaaggcagcagg
ctcgttcacagagtgaacgacgaaaagtatgtgatagaaagagaacttccggatcacgag
gaagcattgaaactcatattgaacacattggtcgatgaaaaacttggagtcataaaagat
ctaaaggagatcgatgccgttggtcacagggtggttcacggtggtgaaagattcaaagaa
tcggtgcttgtggacgaggaagtgctcaaagcgatcgaagaggtttcacctcttgcaccg
cttcacaaccctgcgaatctcatgggaataaaagctgccatgaagctccttccaggagta
ccaaatgtggttgttttcgacacagctttccaccagacgattcctcagaaagcatatctt
tacgctataccgtacgaatactacgagaagcacagaatcagacgctacggttttcacggt
acaagtcacaggtacgtttcgaaaagagcggcggagatccttgggaagaaactagaagaa
ctcaagatcatcacctgtcacataggaaacggagcttcagtagccgctgtgaaatatgga
aagtgcgtcgatacctccatgggattcacaccgcttgaaggactcgttatgggtacaagg
tccggtgatttggatccggcaattcccttcttcatcatggaaaaagaaggtatatccccc
caggagatgtacgatatacttaacaaaaagagtggtgtctacggactttcaaagggcttc
agctccgacatgagggacatcgaagaggctgccttgaaaggagacgaatggtgcaagctc
atcctcgacatctaccactacaggatcgccaaatacataggcgcgtacgctgctgcgatg
aacggtgttgatgccatagtcttcacagccggtgttggagaaaactctccaatcacaagg
gaagatgtgtgttcttacctggaatttctcggagtgaagcttgacaaacagaagaacgaa
gaaacaataagaggaaaggaaggcataatctccactctcgattcccgtgtgaaagtactg
gttgttccaacaaacgaggagctcatgatagcgagggatacgaaagaaatagtcgagaag
attggcaggtaa

DBGET integrated database retrieval system