KEGG   Thermotoga sp. Cell2: CELL2_03450Help
Entry
CELL2_03450       CDS       T03495                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
thz  Thermotoga sp. Cell2
Brite
KEGG Orthology (KO) [BR:thz00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CELL2_03450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 YfhO
Motif
Other DBs
NCBI-ProteinID: AIY88000
Position
complement(657095..658303)
Genome map
AA seq 402 aa AA seqDB search
MTILIVAGILGFIMAFSIGANDVANSMATAVGAKAITVRQASIIAMFLEFLGAVMFGSHV
SQTIVKGIVEVEKVQPVELMYGALSALIAASLWILIATNWGYPVSTTHSIVGGMIGFGLV
AVGIDGVNWKTFLFIVLSWVVSPVLGGLISFVMFKLISLSVFHTKNPKKSSTVAIPFFIS
LAVFTMISLFVKKTLKQPLSESFLLGIAFSLVTFFVVHFAVRKLINEKKDVYEAVEDVFK
RAQILTSCYVSFSHGANDVANAAGPVAAVMIVASTGVVPKTVEIPFLALLLGGIGISLGV
FFLGQRVMETVGEKITTLTNSRGFTVDFSTATTVLLASSLGLPISTTHVVVGAVTGVGFA
RGLEMVNVGVLKNIVISWLLIVPTVAATSAAVYWVLKLILKF
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtgacaatactcatcgtagctggcatacttggtttcatcatggctttctccataggagcc
aacgacgtggcgaattccatggccacagccgttggagcaaaggccataactgtaagacag
gcatccattattgcgatgtttctcgagtttcttggagcggttatgttcggctctcatgtc
tcccagacgattgtcaagggaatagtagaggtggagaaagttcaaccggtagaactcatg
tatggtgcactgtcagccttgatcgcagcttcactctggatcctgatagcgaccaactgg
ggttatcccgtttccaccacccattctatagtcggaggaatgataggattcggtcttgtg
gcggtaggcatagatggcgtgaactggaaaacgtttctcttcatagtactttcctgggtt
gtttcacctgttctcggcggtttgatttcctttgtgatgttcaaactgatctctctttcg
gtgttccacacaaaaaatccgaagaaatcttccactgtggctattccgtttttcatatct
cttgcggttttcacaatgatatctctttttgtaaaaaagacgctcaaacagcctctcagt
gaatcttttctgctcggtattgctttctctctcgtaacatttttcgtagttcacttcgct
gtgagaaagctgataaacgaaaagaaagatgtgtacgaagcggttgaagatgtgttcaag
cgcgctcaaattctcacttcctgctacgtttctttttctcatggagccaacgacgttgcc
aacgcggcaggtcctgtagcagcggtcatgatcgttgcgtcaacgggtgttgttccaaaa
accgttgagatacccttcttggcgcttcttcttgggggaattggtatctcacttggtgtg
ttcttccttgggcagagagtgatggaaacggtaggtgaaaagataacgacgctcacaaat
tccaggggattcaccgtggatttttccactgcgacgacggttctgctcgcttcgtcactt
gggcttcctatctccacgacgcacgttgtggtgggagctgtcacgggtgttggcttcgcc
agaggacttgaaatggtgaacgttggtgtgttgaagaacatcgttatatcctggcttctc
atagtaccaacggtggctgcgacttccgcagctgtttattgggttctgaaactgatatta
aaattctaa

DBGET integrated database retrieval system