KEGG   Thermodesulfatator indicus: Thein_0028Help
Entry
Thein_0028        CDS       T01546                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
tid  Thermodesulfatator indicus
Pathway
tid00780  Biotin metabolism
tid01100  Metabolic pathways
Module
tid_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:tid00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Thein_0028
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tid01007]
    Thein_0028
Enzymes [BR:tid01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     Thein_0028
Amino acid related enzymes [BR:tid01007]
 Aminotransferase (transaminase)
  Class II
   Thein_0028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AEH43913
UniProt: F8A7Z7
Position
complement(30249..31367)
Genome map
AA seq 372 aa AA seqDB search
MDFTAEITKLKEEKRFRRLPLIEARQGPYVKINGKWLLNLSSNDYLGLSEKLSQKEILEE
IKDFPIGAGAARLLSGNHLLYQRLEEKLGNLYQKKALVFSSGYHANVGIISALAGRRDVV
FADKLVHASIIDGLRLSGATYFRYPHGNIEALADLLKSRRFRYKRAFIITESIFSMDGDK
SPLEELIKLKRTYQAFLILDEAHAVGVYGQQGLGLAEEYGLINEIDLLLGTFGKALGGYG
AFVIASEEVIDLLINKARSFIFTTALPPFILAVNLKAISLLPDLKEARSQLRKLSSWFRK
NLGLSGDTPIVPIVLGDNEKALAASAKLFEAGFFVPAIRPPTVPPGTARLRVSLTSQMSE
ENLFSFLRLVEK
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggatttcacggcagaaataaccaaattaaaggaagaaaaacgttttcgccgtcttccc
ttgatagaagctcgccaagggccttatgtaaagataaatggaaaatggctccttaacctt
tcgtcaaacgattatttgggtttgagtgaaaaactttctcagaaagaaattcttgaagaa
ataaaagactttcctataggggcaggggcggcgagacttctttcaggtaaccatcttctt
tatcaacgcctagaagaaaagctcggaaatctttaccaaaaaaaagcccttgttttttct
tcaggctatcacgctaacgtaggaattatttcagcccttgctggacgaagagacgtggtc
tttgcagacaaactagtccacgcaagcataatagacggccttcgtctctcaggagccact
tattttcgttatccccacggaaatatagaagcattggctgacctgcttaaaagtcgtcgt
ttcaggtataaacgggcttttataattacagaaagtatctttagtatggacggagataag
agccctcttgaagaactaataaaacttaaaagaacttatcaggcctttttaatacttgat
gaagctcacgctgttggtgtttatgggcaacaaggtttgggattggcagaggaatacggt
ttaataaatgagatagacttgcttcttggtacctttggcaaggcccttggtggttatggg
gcctttgtgatagctagcgaagaggtaatagatcttttgataaacaaggcccgttctttc
atttttactacagctttacctccttttatcttggcggtcaacctaaaggccatatctttg
ttgcctgatcttaaagaggcgcgcagccaattaagaaaactatcttcctggtttcgtaaa
aatttagggctttcaggagatacccctattgttcctattgttttaggtgacaatgaaaag
gctttagctgcttcagccaaactttttgaagctggtttttttgttcctgctataaggcca
cctactgtgcctccaggaacagctcgcctccgcgtatcccttacctctcaaatgtctgaa
gaaaacttattttcgtttttaaggctagtagaaaaataa

DBGET integrated database retrieval system