KEGG   Thermodesulfatator indicus: Thein_0029Help
Entry
Thein_0029        CDS       T01546                                 

Definition
(GenBank) adenosylmethionine-8-amino-7-oxononanoate aminotransferase
  KO
K00833  adenosylmethionine---8-amino-7-oxononanoate aminotransferase [EC:2.6.1.62]
Organism
tid  Thermodesulfatator indicus
Pathway
tid00780  Biotin metabolism
tid01100  Metabolic pathways
Module
tid_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:tid00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Thein_0029
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tid01007]
    Thein_0029
Enzymes [BR:tid01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.62  adenosylmethionine---8-amino-7-oxononanoate transaminase
     Thein_0029
Amino acid related enzymes [BR:tid01007]
 Aminotransferase (transaminase)
  Class III
   Thein_0029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AEH43914
UniProt: F8A7Z8
Position
complement(31367..32746)
Genome map
AA seq 459 aa AA seqDB search
MKSWNKKKILEIDKKHIWHPYTQMKDYENRDPLVIVAANGCKLKTIDGDELYDSISSWWT
TLHGHLHPKLNQAIMEQLKLLDHVNFSGYTHPYAVEVVERLKNFLPHTLSRFFFSDNGST
AVEVALKMAFQFWQNRGVNSKTRFVCLENAYHGDTLGAVSVGGVDLFFELYKPLLFKSFK
APSPYCYRCEEKEGFTLDANHECNLRCLDGLEKILNEHHEEICAVIVEPRLQGAGGILVY
PAAYLKKLREITEQFKVFLIFDEVATGFGRTGTMFAFEQAGIAPDIICLAKGLTGGYLPM
ALTVTTEEIYQAFYADYLEGKTFYHGHTYTANPICCAVAAASLKLFAEEEPLVKTKEARE
YFHQLLLDTFSDKPYVGDIRYIGYVGAIELVRDKKTKEPFSEELRLGFNIYMKSLEKGVV
LRPLGDVIYWFLPLCISKTEVEEILKISAEVIEEVLINL
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagctggaataaaaagaaaattttggaaattgataaaaagcacatctggcatcct
tacactcagatgaaagattatgaaaaccgtgacccattggtcatagttgccgctaatggc
tgtaagctaaaaacaatagatggcgatgaactttatgattctatttcttcctggtggact
actttgcatggacaccttcatccaaagcttaatcaagccataatggaacagctaaaactt
ttagatcacgtgaacttttcaggttatacccatccttatgcagtagaagtagtagagcgt
ttaaaaaattttttaccacatacactttcgcgcttttttttctctgataatggttcaacg
gcggtagaagtagccttaaaaatggcctttcagttctggcaaaacagaggagtaaattcc
aaaactcgttttgtatgtctggaaaatgcctatcacggcgataccttaggggcagtaagt
gttggaggggtagatctttttttcgaactctataagccgcttcttttcaagtcctttaaa
gcgccaagcccctattgttatcgttgtgaagaaaaagaaggctttactctagacgccaat
cacgagtgtaacttacgttgtctggatgggttagaaaaaattcttaatgaacatcatgaa
gaaatttgtgccgttattgtggagccccgtcttcaaggggcagggggaattttagtttac
cctgctgcttatttaaaaaaactaagagagattaccgaacaatttaaagtttttctaatt
ttcgatgaagtagctacaggttttgggcgcacagggaccatgtttgcctttgaacaggca
gggatagcgccagacattatttgtctggccaaaggcttaactggcgggtatctccctatg
gccttgacagtaactaccgaagaaatttatcaggccttttacgctgactacctggaaggg
aaaacgttttatcacggccacacttatactgccaatcccatttgttgtgcagtggcggcg
gctagtcttaaactttttgccgaagaagagccgctagtcaaaactaaagaagcccgagaa
tattttcaccagttattgcttgatactttttcagataaaccctacgtaggtgatatacgc
tatatcggttatgtgggagccattgagctggtaagagataaaaaaacaaaagaacctttt
tctgaagagttgagattgggtttcaatatttacatgaagtccttggaaaaaggtgtagtt
ttgaggcctcttggagacgttatttactggtttttgcctttgtgtataagtaaaaccgag
gtagaggaaattttaaaaatcagtgctgaagttatcgaagaagttctgattaatttgtaa

DBGET integrated database retrieval system