KEGG   Thermodesulfatator indicus: Thein_0032Help
Entry
Thein_0032        CDS       T01546                                 

Definition
(GenBank) protein of unknown function DUF164
  KO
K07164  uncharacterized protein
Organism
tid  Thermodesulfatator indicus
Brite
KEGG Orthology (KO) [BR:tid00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Thein_0032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-RING_7 FPP Fez1 GrpE Tropomyosin DUF4446 DUF4795 Spc7 ATG16 TPR_MLP1_2 APG6 Tektin
Motif
Other DBs
NCBI-ProteinID: AEH43917
UniProt: F8A8B3
Position
complement(34440..35204)
Genome map
AA seq 254 aa AA seqDB search
MREEIVNLIKLQEIDLKILALDKAKDEFPESLKKAEEALAQKKNEMEALENEIEELKFKR
RKFEEELEQEYQRLKKSQTRLMEVKAQREYQALLKEIEEIKKANKLREEELLKMMERVEE
LTKQKEDLKNEIAELEKQVEEEHQKYETRRAELDKEREGIWKEREAIAKNIPGNLLKRYE
FIKSHRNGVAVVPVINAVCDGCHMNIPPQLYNELQRDDKVYECPICQRIIFFKKEYSDIL
PQDEEGEEAKEAQA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtgcgggaggaaatcgtaaatctcatcaaattacaggagattgatttaaaaattttggct
ttggataaggccaaggatgaattcccagagtctttaaagaaggccgaggaggcccttgct
cagaaaaagaatgaaatggaagcacttgaaaacgaaattgaggaactgaagtttaaacgg
cgtaagtttgaagaggaacttgagcaagagtatcagcgtcttaaaaagagtcagacccgc
cttatggaggtcaaggcccagagagaatatcaggcccttctaaaagaaatagaagaaatt
aaaaaggccaacaagcttcgcgaagaagaacttcttaaaatgatggaacgcgtggaagag
cttaccaaacagaaagaagacctaaaaaatgaaatagcggaacttgaaaaacaggttgaa
gaagaacaccaaaaatatgaaactcgccgggcagagcttgataaggaaagggaagggatt
tggaaggaaagggaagctattgctaaaaatattcctggaaatctcctcaaacgttacgaa
tttattaaatctcaccgtaacggggtggcggtggtgccggtgataaatgccgtttgtgac
ggttgccatatgaatatccctcctcagctttataatgaattgcagcgagatgacaaggta
tatgagtgtcctatttgtcagcggattatattctttaaaaaagaatactctgatattttg
ccgcaagatgaagaaggcgaagaagccaaagaggctcaggcttaa

DBGET integrated database retrieval system