KEGG   Thermodesulfatator indicus: Thein_0038Help
Entry
Thein_0038        CDS       T01546                                 

Definition
(GenBank) Sua5/YciO/YrdC/YwlC family protein
  KO
K07566  L-threonylcarbamoyladenylate synthase [EC:2.7.7.87]
Organism
tid  Thermodesulfatator indicus
Brite
KEGG Orthology (KO) [BR:tid00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:tid03009]
    Thein_0038
   03016 Transfer RNA biogenesis [BR:tid03016]
    Thein_0038
Enzymes [BR:tid01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.87  L-threonylcarbamoyladenylate synthase
     Thein_0038
Ribosome biogenesis [BR:tid03009]
 Prokaryotic Type
  Other maturation factors
   Thein_0038
Transfer RNA biogenesis [BR:tid03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    Thein_0038
 Prokaryotic Type
    Thein_0038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sua5_yciO_yrdC SUA5
Motif
Other DBs
NCBI-ProteinID: AEH43923
UniProt: F8A8B9
Position
complement(42677..43621)
Genome map
AA seq 314 aa AA seqDB search
MPILKPTLDNIKKAAELLRAGDLVVFPTETVYGLGANVFDERAVTKIFELKRRPYFDPLI
VHVADIAMAEVAVFDERARALAKRFWPGPLTLILPKKPKVPDIVTSGLSSVAIRMPAHEV
ALALIKECGFPLAAPSANPFGQLSPTRAEHVLSYFGEKLFILEGGECQVGLESTILDLTE
KEPVLLRPGGVPMEALKEVLGEIKIKRKPEKPKAPGQLKSHYAPRTPLKIWQKNLEIKGK
KIGFLAFSKAPEGKYEAVRILTPSGDLREAAANLFKYLHELDQMGLDLILVEPVPEEGLG
LAIMDRLRKAEAAF
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgccaatattaaaacccacacttgataacatcaaaaaagcagctgagcttttaagggcc
ggagatttggtagtctttcctacggagacggtctatggcctgggagccaatgtatttgat
gaaagggcggtgaccaagatttttgaactcaaaaggcgcccgtactttgatcctttgatt
gtccacgtggctgatatcgctatggccgaggtggccgtctttgacgagcgagccagggct
ttggccaagcgtttttggcctggccccttgactttgatcctccccaaaaagcccaaagtg
ccagatattgttacttccgggctttcttcagtagccataagaatgccagcccatgaggtg
gcgctagcccttattaaggaatgtggttttcctttggctgctcccagtgctaaccccttt
gggcagcttagccccaccagggccgaacacgttctttcttactttggagagaagcttttt
attcttgagggcggtgaatgtcaggtagggcttgagtcaactatccttgatttgactgaa
aaagaaccggtactcttgcggcctggtggcgtgcctatggaagctttaaaggaagttctg
ggggagatcaaaataaaaagaaagcctgaaaaaccaaaggccccggggcagttaaaaagt
cattatgccccaagaactccgcttaaaatctggcaaaaaaacttggagataaagggcaaa
aagataggttttctcgctttttctaaagctccagaaggtaagtatgaagcggtgcggata
cttactccttcaggagacttgagggaagcggcggccaatctttttaagtatttacacgag
cttgaccagatgggccttgacttaattttagtggaacctgtacctgaagaaggcctggga
ctggctattatggaccgccttagaaaggccgaagctgctttttaa

DBGET integrated database retrieval system