KEGG   Thermodesulfatator indicus: Thein_0045Help
Entry
Thein_0045        CDS       T01546                                 

Definition
(GenBank) 1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR) carboxylase
  KO
K06898  pyridinium-3,5-biscarboxylic acid mononucleotide synthase [EC:2.5.1.143]
Organism
tid  Thermodesulfatator indicus
Brite
KEGG Orthology (KO) [BR:tid00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Thein_0045
Enzymes [BR:tid01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.143  pyridinium-3,5-biscarboxylic acid mononucleotide synthase
     Thein_0045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRC AF0941-like
Motif
Other DBs
NCBI-ProteinID: AEH43930
UniProt: F8A8C6
Position
complement(50245..51012)
Genome map
AA seq 255 aa AA seqDB search
MMREKIRKVLEALAQGKMTQEEAEEALSLAPFEDLGFARLDHHRGIRKHFPEVIYGPGKT
EEELIKITETFLAKKLSLLITRVESQKAQAVLKKFPELSYSSRARLIYHLPEKREPKGYI
LIACGGTADLPVVEEARICAEAFGNRVEVIVDVGVAGVHRIVPELPKLRQARVIICVAGM
EGALPSLVAGLIDVPIIAVPVSAGYGANFQGLAPLLTMLNSCAAGVAVVNIDNGFGAAYM
ASLINQLPERVFSRA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgagaaaaaataagaaaagttcttgaagccctggcccaagggaaaatgacccaa
gaggaagccgaagaggctttatctctagctccttttgaagacttaggctttgctagactt
gatcatcaccgaggtattcgtaagcactttccagaagtgatttacggcccaggtaaaact
gaagaagaacttataaagattaccgagacttttttggctaaaaaactttctttgcttatt
accagagtggaatctcaaaaagcccaagcggttctcaaaaaatttccagagctttcttat
tcttctcgagcaaggcttatctatcatttgccagaaaaaagagaacctaaaggttatatt
ctcattgcctgtggaggcacagcagatcttcctgtagtagaagaagcccgcatttgtgcg
gaggcctttggcaacagagtagaggttattgttgacgtgggtgttgctggtgttcaccgt
attgtgccagagcttcccaagttacgccaagcccgagttattatttgtgtggctggtatg
gaaggggccttaccaagtctggtagcaggactgatagatgttcccataatagctgtaccg
gtaagtgcgggttatggggccaactttcaggggcttgctccccttcttactatgctaaac
tcctgtgctgctggggtggcagtggtaaacattgataatggctttggcgcagcttatatg
gccagccttataaatcagcttcctgaaagggtcttttcccgtgcgtaa

DBGET integrated database retrieval system