KEGG   Thermodesulfatator indicus: Thein_0051Help
Entry
Thein_0051        CDS       T01546                                 

Definition
(GenBank) RimK domain protein ATP-grasp
  KO
K05844  ribosomal protein S6--L-glutamate ligase [EC:6.3.2.-]
Organism
tid  Thermodesulfatator indicus
Brite
KEGG Orthology (KO) [BR:tid00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:tid03009]
    Thein_0051
Enzymes [BR:tid01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.-  
     Thein_0051
Ribosome biogenesis [BR:tid03009]
 Prokaryotic Type
  ribosomal protein modification factors
   Thein_0051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RimK GSH-S_ATP
Motif
Other DBs
NCBI-ProteinID: AEH43936
UniProt: F8A8D2
Position
55439..56230
Genome map
AA seq 263 aa AA seqDB search
MRNPWVILSNRALRKLYHELQAGDAFIGRLAVKYGEEFIFLDLEARGVKAYPSLLAQHLA
RSKCFQAQVFSHFMLPHTRLIRDRHDLIKTANEYGSLGVKKVVLKQDRFNCGLGIHLFEH
IEEVMNLASFGNLPYPFVLQPFAEEITDVRVIILGNYLEAYSRKNPYNFRNNLFFGGEAK
PYKLNDEELSFCKKVMKRGDFPYAHIDLMILPDGRFYLSEINLRGGLKGAQITAKDYEAK
VEELHRNFLQKYLEKNPQAKVWE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaatccctgggtaattctttccaaccgggcccttcgcaaactataccatgaatta
caagcaggagacgcctttataggaaggcttgcagtaaaatacggtgaggaatttatcttc
ctagaccttgaagcccgtggggtcaaagcttatccatctcttttggcccaacatctggcc
cgctctaaatgctttcaggctcaggtgtttagccatttcatgctccctcatacccgactt
attagagaccggcacgatcttattaaaaccgctaacgaatacggctctctcggtgttaaa
aaagttgttttaaaacaggaccgttttaactgtggcctaggcatacatcttttcgaacac
atagaagaagttatgaatctggcaagctttggaaatctcccctatccttttgttttacag
ccttttgccgaagaaataactgatgtgcgggtaatcatcttgggtaattatcttgaagct
tactcacggaaaaatccttataactttcgcaataaccttttttttggcggagaagctaaa
ccttacaagctaaatgatgaagagctttcgttttgtaaaaaggtaatgaaaagaggcgat
ttcccttacgcccacattgatcttatgatactgcctgacggacgtttttatctttcagag
ataaacttgcgaggaggcttaaaaggcgcccaaataacagcaaaagattacgaggccaaa
gttgaagaacttcaccgaaattttctccaaaaatacctagaaaaaaatccgcaagccaaa
gtgtgggaataa

DBGET integrated database retrieval system