KEGG   Thermodesulfatator indicus: Thein_0055Help
Entry
Thein_0055        CDS       T01546                                 

Definition
(GenBank) SirA-like domain-containing protein
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TusA DUF2249 ATPase DHBP_synthase
Motif
Other DBs
NCBI-ProteinID: AEH43940
UniProt: F8A8D6
Position
complement(57825..58037)
Genome map
AA seq 70 aa AA seqDB search
MNTVDARGLSCPQPVLLTLEAIEKMKEGELVVLVDTEAARENVSRAVASKGWKVKEIVEE
NGEYKLIIAK
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagtagatgccagagggctttcctgtcctcagcctgttttactaacccttgaa
gctattgaaaaaatgaaggaaggtgagctggtggtcctggtagataccgaagcggctaga
gaaaacgtaagtcgggctgtagcttctaaaggctggaaggttaaagaaatagttgaagaa
aatggcgaatacaaacttataatcgctaaatag

DBGET integrated database retrieval system