KEGG   Thermodesulfatator indicus: Thein_0060Help
Entry
Thein_0060        CDS       T01546                                 

Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
tid  Thermodesulfatator indicus
Pathway
tid00860  Porphyrin and chlorophyll metabolism
tid01100  Metabolic pathways
tid01110  Biosynthesis of secondary metabolites
tid01120  Microbial metabolism in diverse environments
Module
tid_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:tid00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Thein_0060
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tid01007]
    Thein_0060
Enzymes [BR:tid01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     Thein_0060
Amino acid related enzymes [BR:tid01007]
 Aminotransferase (transaminase)
  Class III
   Thein_0060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AEH43945
UniProt: F8A8E1
Position
61376..62662
Genome map
AA seq 428 aa AA seqDB search
MAGILSQKFFEKAKELIPGGVNSPVRACKSVGVDPVFFSAGTGPFLIDVEGKEYIDYVAS
WGPLILGHAHPEVVSAIQAAAENGTSFGAPTWGEVELAELICQIFPSIEKVRLVNSGTEA
TMSAVRLARGFTNRKKIIKFDGCYHGHADSFLVKAGSGIATLGIPGSPGVPEEIVKNTIS
LPYNDLDAVKEAFAKMGEEIACVIVEPIAGNMGVIPPEPGFLEGLRELTKKYGSLLIFDE
VITGFRVSLAGAQGLYGVEPDLTCLGKIIGGGLPVGAYGGKAEIMAHIAPEGPVYQAGTL
SGNPIAVAAGIATLKVLMRPGVYEYLEALSEKLANGLAEAAKEAGAKVTFNRVGSMMTCF
FREGEVKNFADAAGSDTERYGQFWREMLARGVYLAPSQFEAAFVSLAHTEEEIDHTIEAA
REAFAIVA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggctggtatcctatcacaaaaattttttgaaaaagccaaagaattaatacctggagga
gttaattcgccggttagggcctgcaagtctgttggggtagatccagtattttttagcgcc
ggcactggcccatttttaattgacgttgaaggcaaagaatacatagactacgtggcttct
tgggggccacttatcctggggcatgcccatccagaagtggtctctgccatccaggctgcg
gcggaaaacggcacaagctttggcgctcccacctggggagaagtggaacttgccgagctt
atttgccaaatattcccttctatagaaaaagttaggctcgtaaattccggcaccgaagcc
actatgagtgccgtgcgcctggctcgcgggtttaccaaccgcaaaaaaatcataaagttt
gacggctgttaccacggccacgcggattcttttttggtaaaagccggctcaggaatagcc
accctgggtattcctggaagccccggcgtgcccgaagaaatcgttaaaaacaccatctcg
cttccctacaatgaccttgacgccgtaaaagaggcctttgccaaaatgggagaagaaatt
gcctgcgtaattgttgagcccattgccggaaacatgggcgtcattcccccagagcctggc
tttcttgagggcttgagagagcttactaaaaaatatggctctttacttatttttgatgag
gttataaccggcttcagagtgagcctggccggagcccaggggctttacggcgtagaacct
gacctcacctgcctcggcaaaattataggtggtggccttccagtaggagcttacggtggt
aaagccgaaatcatggcccatattgctcctgaaggcccggtttatcaagcaggcaccctt
tcaggaaaccctatcgccgtagccgcaggcatagccactttaaaagtcttgatgcgccct
ggtgtttacgaataccttgaagccctttctgaaaaattggccaatggtcttgctgaagca
gctaaagaagccggagccaaggtcacctttaaccgcgtaggctccatgatgacctgcttt
ttccgagaaggagaagtcaaaaactttgctgacgccgccggctctgacactgagcgttat
ggccagttttggcgagagatgcttgctcgcggagtgtatttagcaccttctcagtttgag
gccgcttttgtttctctggctcatactgaagaggagatagaccatacgatagaagcggcc
cgcgaggcctttgctatagtggcctaa

DBGET integrated database retrieval system