KEGG   Thermodesulfatator indicus: Thein_0063Help
Entry
Thein_0063        CDS       T01546                                 

Definition
(GenBank) protein of unknown function DUF81
  KO
K07090  uncharacterized protein
Organism
tid  Thermodesulfatator indicus
Brite
KEGG Orthology (KO) [BR:tid00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Thein_0063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE LapA_dom
Motif
Other DBs
NCBI-ProteinID: AEH43948
UniProt: F8A8E4
Position
64666..65574
Genome map
AA seq 302 aa AA seqDB search
MKKAPLNFLFKKVTFPISGVKTWIFLPPLVAFFLAYFGSMAGVTGAFLLLPFQMSVLGYT
TPGVSATNFFYNLFAIPGSLWRYTKQGRLNWPLSLCISLGSASGIVLGYFLRIKFLTDPS
KFKPFAGFVLLYLAFRLGKDLVYGKNKPTPSKKEVIVYLKLSLKEISFSFDQQVYSFSPS
KVFGVSFLVGIAGGAYGIGGGAIMSPYCVSMLGLPVHTVAGASLLGTFISSVIGVTIYTL
GLGAKGISTKPDYLLGVLFGLGGLAGGILGARTQKFIPERPIKLGLFLVVLLVSLRYLLS
WF
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagctcctttaaattttttatttaaaaaagtaacctttcccatttcaggggta
aaaacctggatatttttaccacctctggtggcatttttcttggcctattttggcagtatg
gctggagtaaccggggcctttctccttttaccttttcagatgagcgttctcggctataca
actcctggagtttcggctactaactttttttataatctttttgccattccagggagcctt
tggcgctataccaagcaagggcgacttaactggccgcttagcctctgtatatctcttgga
agtgcttctggaatagttctcggctattttttgcgaatcaaatttttgacagatcctagt
aagtttaagccctttgccggatttgttctactttatcttgcctttcggttaggaaaagat
ttagtttacggcaaaaataagccaacaccttctaagaaagaagtaattgtttatctaaaa
ttatctttaaaagaaatttccttttcctttgatcagcaggtctattctttttctccaagc
aaagtctttggtgtttcttttctagttggaattgctggtggagcttacggtattggcggc
ggagctattatgtctccctattgtgtaagtatgttaggcctccccgttcacacagtagca
ggtgcctctcttttgggaacttttatatcatctgttattggtgtaaccatttataccctc
ggcttaggagctaagggtatttctacaaaacctgattatttactcggtgtcttatttggc
cttggaggtctggctggaggtattctgggggcgcgtactcaaaaatttattcccgaacga
cctataaaattgggcctctttctggtggtgctgttggtttccttgcgatacctcctgagc
tggttctaa

DBGET integrated database retrieval system