KEGG   Thermodesulfatator indicus: Thein_0065Help
Entry
Thein_0065        CDS       T01546                                 

Definition
(GenBank) Alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
tid  Thermodesulfatator indicus
Pathway
tid00730  Thiamine metabolism
tid00790  Folate biosynthesis
tid01100  Metabolic pathways
tid02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tid00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Thein_0065
   00790 Folate biosynthesis
    Thein_0065
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Thein_0065
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tid04147]
    Thein_0065
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:tid00537]
    Thein_0065
Enzymes [BR:tid01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Thein_0065
Exosome [BR:tid04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Thein_0065
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:tid00537]
 Enzymes
  Thein_0065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-ProteinID: AEH43950
UniProt: F8A8E6
Position
complement(67685..69199)
Genome map
AA seq 504 aa AA seqDB search
MFKKLRFIISLCFCLLFIQVLSAHAFTYPDRVFFHKPQVKVKKAKYVILLIGDGMGYWHV
DALRRYLNVSKTNMESLRYFGYMTTFMRNSTGEGGLSGEYWDDPNELGSYDPALGGRTPW
EIQPVPAYVDEGATDSAAAGSALASGHKTVKYALNVVPKPEGYPADEPFTVKYYPTIVDF
AEAKGMATGVVTSVPFSHATPAAFIAKTQYRKNYGEIARQMIFSNLDVIMGAGHPYYDDN
GNLREEPNFYYWSRNKGPYIDDEDGEALYEKVVNGVRGRVFVDKKEDFEDLADGDGLFHG
GPMPRRVFGLAQVANTLQASRNIDDGDPSDDWKVGGQAFITNVPSLETMTRAALEVLEQD
EDGFFVMIEGGAIDWASHANNMTRMLEEIIDFDNAVKAVIDWVNDPNNGSNWDNTLVVVV
ADHETGHLQPLNVTGDEVIKEQCWGLNCEGWHHHTNSLVPIYAQGVCARALKAKYDGDIK
DNTQIFKVMYQAIERGCYELRIPE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaattacgtttcattatttcgttatgtttttgtctgttatttattcaggtt
ttgtcagcccatgcctttacttatcctgaccgagtcttttttcacaaaccgcaggttaag
gtcaaaaaagctaagtacgtcatacttttgataggagacgggatgggctattggcacgtt
gatgccttacgtagatacttgaatgtaagcaaaaccaatatggaaagccttaggtacttt
ggttatatgactacttttatgagaaattctacaggagaaggtggacttagtggagaatac
tgggatgatcctaacgaacttggtagttatgatcccgcgctaggaggtcgtactccgtgg
gaaatacaaccagttcctgcttatgtagatgagggggctacagattcggcagctgctggt
agcgcactagccagtggccacaaaacagtaaaatatgcattgaatgtagttcctaagcct
gaaggatatcctgctgatgaaccttttacggtcaaatattatcccaccattgttgatttt
gccgaggccaaaggtatggccaccggcgtagtaaccagtgttcctttctcccatgccact
cccgctgcttttattgccaaaacccagtaccgtaaaaattatggggaaatagctcgtcaa
atgattttttctaacttggatgtaattatgggagccggacatccttattacgatgacaac
ggcaatctacgcgaagagcctaacttttattactggtctcgcaataaaggaccctatatc
gatgatgaagacggtgaagctttatatgaaaaagtagtaaacggagtaagaggtagagtt
tttgtcgataaaaaagaagattttgaggatttagccgatggtgacggactctttcacgga
ggccctatgcctagacgggtattcggattggctcaggtagctaatactttacaggcttct
cgcaacatagatgatggagatccttctgatgactggaaagtcggtggccaggcctttata
accaatgttccctctcttgaaaccatgaccagagctgctcttgaagtgcttgaacaggac
gaagacggcttttttgtaatgattgaaggcggagccattgattgggctagccacgctaac
aacatgaccagaatgcttgaagaaataattgattttgataatgctgtcaaagcagttatt
gattgggttaatgaccccaataatggaagcaattgggacaatactttggtggttgtagtg
gctgatcacgaaaccggacatctccagcctttaaatgtaaccggcgacgaagttataaaa
gaacaatgctgggggctaaattgtgaaggctggcatcatcataccaatagtctggtaccg
atctatgcccagggagtgtgcgccagagccttaaaggccaaatatgatggagacataaaa
gacaatactcaaatctttaaggtaatgtatcaggctattgaaaggggctgctacgaacta
agaatacctgaataa

DBGET integrated database retrieval system