KEGG   Thermodesulfatator indicus: Thein_0089Help
Entry
Thein_0089        CDS       T01546                                 

Definition
(GenBank) peptidoglycan-associated lipoprotein
  KO
K03640  peptidoglycan-associated lipoprotein
Organism
tid  Thermodesulfatator indicus
Brite
KEGG Orthology (KO) [BR:tid00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tid02000]
    Thein_0089
Transporters [BR:tid02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Thein_0089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OmpA
Motif
Other DBs
NCBI-ProteinID: AEH43974
UniProt: F8AE39
Position
87916..88530
Genome map
AA seq 204 aa AA seqDB search
MKKLNLLLILMVGLFVVSCAKKEIPTGVEEAPPPAVKKESAPQTKPAEEAKVPSQETPKL
SEPPIFEEVGLEPQNPEWIDAHREELLLYGRSTRPFKAIFFDFDSYYIRDDMKDRLQENA
RFLLENPEIKVELQGNCDERGSSEYNLALGEKRALAVKRYLINLGVSPERLITVSFGEER
PLDPRHNEEAWALNRRVDFVVIKK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacttaatttgttgttaattttgatggtaggattgtttgttgtctcttgtgcc
aaaaaagaaataccaactggagtagaagaagcacctccacctgcagtaaaaaaagaatct
gctccgcagacaaagccggccgaagaagccaaagttccctctcaagaaactcctaagctt
tcagaaccccctatatttgaagaagtaggccttgaaccccaaaatccggaatggatagac
gcccaccgtgaagaacttttactttatggccgcagcaccagaccttttaaggccatcttt
tttgactttgattcctattatattcgtgatgacatgaaagatcgtttgcaagagaacgcc
cggtttctcttagaaaatccagaaataaaagtagaacttcagggcaactgtgacgaacgc
ggctcaagcgaatataacttggctcttggagaaaaaagggcccttgccgtgaaacgctat
cttataaacctgggtgtttctccagaaaggcttatcaccgtaagttttggcgaagagcgg
cctcttgatcccaggcataacgaagaggcatgggcgcttaaccgccgagttgactttgtg
gtaatcaaaaaataa

DBGET integrated database retrieval system