KEGG   Thermodesulfatator indicus: Thein_0090Help
Entry
Thein_0090        CDS       T01546                                 

Definition
(GenBank) outer membrane chaperone Skp (OmpH)
  KO
K06142  outer membrane protein
Organism
tid  Thermodesulfatator indicus
Brite
KEGG Orthology (KO) [BR:tid00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    Thein_0090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OmpH CENP-Q IncA Med30 V-ATPase_H_C Exonuc_VII_L FapA LMBR1 Atg14 Histidinol_dh YusW Borrelia_P83 Mnd1
Motif
Other DBs
NCBI-ProteinID: AEH43975
UniProt: F8A8G7
Position
88550..89077
Genome map
AA seq 175 aa AA seqDB search
MKRLAILIVFGILLLSTNSWATEAKIGVVDIQTVVRNSQAGQEALKKLQAKFETLKAKLQ
KKESELRKFKTELEKKAPLLSPEARKEKEREYQKMLREYQAAREDAQFEMKQEEEKALKP
IMQDLDKIIKDMAKKEGYDLILEKRMPGLYWASEKIDITKHLIELYNKYWTTKKK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggctggcaattttaatagtttttgggattttacttttgagtacaaatagctgg
gccactgaagccaaaattggcgtggttgatatccagacagtagtcagaaactctcaggcc
gggcaagaggctcttaaaaaacttcaggccaagtttgaaactttaaaagccaaactccaa
aaaaaagaaagcgaattacgtaaatttaaaacagaacttgaaaagaaagcgcctctcctc
tccccagaggcacgcaaagaaaaagaacgggaataccaaaaaatgctaagagaatatcag
gccgccagagaagatgcccagtttgaaatgaagcaagaagaagaaaaggccttaaaaccc
ataatgcaggatttagataaaataataaaagacatggctaaaaaagaaggttacgacctt
atccttgaaaaaaggatgcccgggctttattgggcttcagaaaaaatagacattaccaaa
catttgattgaactttacaacaagtactggaccaccaagaaaaagtaa

DBGET integrated database retrieval system