KEGG   Thermodesulfatator indicus: Thein_0091Help
Entry
Thein_0091        CDS       T01546                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tid  Thermodesulfatator indicus
Pathway
tid00010  Glycolysis / Gluconeogenesis
tid00052  Galactose metabolism
tid00500  Starch and sucrose metabolism
tid00520  Amino sugar and nucleotide sugar metabolism
tid00521  Streptomycin biosynthesis
tid01100  Metabolic pathways
tid01110  Biosynthesis of secondary metabolites
tid01120  Microbial metabolism in diverse environments
tid01130  Biosynthesis of antibiotics
tid01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tid00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thein_0091
   00052 Galactose metabolism
    Thein_0091
   00500 Starch and sucrose metabolism
    Thein_0091
   00520 Amino sugar and nucleotide sugar metabolism
    Thein_0091
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Thein_0091
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Thein_0091
Enzymes [BR:tid01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Thein_0091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase MRP-L20
Motif
Other DBs
NCBI-ProteinID: AEH43976
UniProt: F8A8G8
Position
89077..90060
Genome map
AA seq 327 aa AA seqDB search
MILAGDIGGTKALLAIYETTGPARPKKLRLLYTKNFSSITELLKTYVSEFSFKPKYLALA
VAGPVIKGWVNMVNVGWRFSANQLAKKFGCSEVFLLNDLEAMAYSLPFISRKHLYSIKAG
HQDKKGNIAVIAAGTGLGEALLIRKEDSIFPVATEGGHADFAPWDELTYRLHAYLAKKFG
HVSWERVVSGPGIENIYFFLCQEKGITPRLSSAKEIGPAGLEAKDPLAEKTLEIFFYAYG
AEAGNLALKSLATGGVFIGGGIAPKLFPFFERGIFQKAFLAKGRHQELLEGMPIWLVKHP
YPALQGAALFARHRLAKGQRKEHEFSS
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgattttagcaggagacataggcgggactaaggccctactggccatctacgaaacaact
ggtcccgccaggcccaaaaaattacgtctcctttatacaaaaaatttttcaagtattact
gagctcttaaaaacctacgtttcagagttctcatttaagcctaagtatctcgctttagct
gtagctggcccggtaatcaaaggctgggtaaatatggtaaacgtgggctggcgcttctca
gccaatcaactggctaaaaagttcggttgttcagaggtttttcttttgaatgaccttgag
gccatggcctattcacttccttttatttctagaaaacacttatactcaataaaagccggg
caccaggataaaaaaggaaatatagcagtcatcgctgctggcaccggccttggcgaagct
ctattaataaggaaagaagattcaatttttcctgtagccaccgaaggtgggcacgctgat
tttgctccgtgggacgaacttacctaccgtttgcatgcttatcttgctaaaaaatttggt
cacgtgagctgggaaagggtagtctccggcccaggaattgaaaacatatacttttttctc
tgccaagaaaaaggcattactcctcgtctatcttctgctaaagaaataggcccagcaggc
ttagaagctaaagatcctctagcagaaaagaccctggaaatatttttttacgcttacggt
gctgaagccggaaatctggccttaaaaagtctggctactggcggagtttttataggaggc
gggattgccccaaaactttttcccttttttgaaaggggaatttttcaaaaggctttttta
gctaaaggaagacaccaagaattactagaaggaatgcccatctggctggtgaaacaccct
tatcccgccttacaaggagcagccctatttgcccgtcaccgattggcaaaaggtcaaagg
aaagagcatgaattttctagctag

DBGET integrated database retrieval system