KEGG   Thermodesulfatator indicus: Thein_0092Help
Entry
Thein_0092        CDS       T01546                                 

Definition
(GenBank) hypothetical protein
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MGC-24
Motif
Other DBs
NCBI-ProteinID: AEH43977
UniProt: F8A8G9
Position
90044..90382
Genome map
AA seq 112 aa AA seqDB search
MNFLASILLWLAYLLLAAHFWRHAQIELALILAVLPSLLVLKRWPIRLILSLGLLAGLGL
WVKTFYYLKNFYAVHNIPFLKAGFILGGVVVLTLLASLFNLYQALKSRSSQS
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgaattttctagctagcatccttttatggttagcctatctccttttggccgctcacttt
tggcgacacgcccagatagaattagccttgatcctggccgttttaccctctttattagta
ctaaaaagatggccaatcagactaattctaagcctgggacttctggccggattggggctt
tgggttaagacattttattatttaaagaatttttacgcagtgcataatattcctttttta
aaagctggttttattttgggaggggtggttgttttaactttattagcatcgctgtttaat
ttataccaggctcttaagtccagatcttctcaatcctag

DBGET integrated database retrieval system