KEGG   Thermodesulfatator indicus: Thein_0097Help
Entry
Thein_0097        CDS       T01546                                 

Definition
(GenBank) hypothetical protein
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zn_Tnp_IS91 Zn-ribbon_8 DZR MCM_OB HypA Lar_restr_allev zf-ribbon_3 zinc_ribbon_2 zf-ISL3 NRDD CpXC
Motif
Other DBs
NCBI-ProteinID: AEH43982
UniProt: F8A8H2
Position
complement(94761..94868)
Genome map
AA seq 35 aa AA seqDB search
MAVFRCEKCGATKEGRCKPRKCPKCGEQGTMKKES
NT seq 108 nt NT seq  +upstreamnt  +downstreamnt
atggcggttttccgttgtgaaaagtgtggagccactaaagaaggccgttgtaaaccgcgt
aaatgccctaaatgtggtgaacagggtaccatgaaaaaagaaagctag

DBGET integrated database retrieval system