KEGG   Thermodesulfatator indicus: Thein_0098Help
Entry
Thein_0098        CDS       T01546                                 

Definition
(GenBank) ferric uptake regulator, Fur family
  KO
K09825  Fur family transcriptional regulator, peroxide stress response regulator
Organism
tid  Thermodesulfatator indicus
Brite
KEGG Orthology (KO) [BR:tid00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tid03000]
    Thein_0098
Transcription factors [BR:tid03000]
 Prokaryotic Type
  Helix-turn-helix
   Fur family
    Thein_0098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FUR LexA_DNA_bind TrmB PadR HTH_20 zf-AD
Motif
Other DBs
NCBI-ProteinID: AEH43983
UniProt: F8A8H3
Position
complement(94871..95287)
Genome map
AA seq 138 aa AA seqDB search
MTKEKIEYYRKLGLKMTPQRLAILEFLDGNTSHPSAEDIYRHVEGKFPSMSFATVYNTLE
ALKEKGLIRELSIEPGKKRFDPNPSPHHHFICERCHQVYDIFEDFQINLPEEYQKQFEIR
ECEIIFRGICADCKRKEV
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaaagaaaagattgaatactatcgtaagttagggcttaagatgactccgcagcgt
ttggccattttagaatttttagacggtaatacctctcatccttcggctgaagatatttat
cgtcacgtggagggaaagttccccagcatgtcttttgccacggtttataacaccttagaa
gccttaaaagaaaagggtttgatacgagagctgagcatagaaccgggtaaaaaacgtttt
gatccgaacccttctcctcaccatcattttatttgtgaaagatgccatcaagtctatgat
atttttgaagattttcagataaatcttcctgaggaatatcaaaagcaatttgagataaga
gaatgtgagatcattttccgtggtatttgtgcagattgcaaaagaaaggaggtgtag

DBGET integrated database retrieval system