KEGG   Thermodesulfatator indicus: Thein_0100Help
Entry
Thein_0100        CDS       T01546                                 

Definition
(GenBank) methyl-accepting chemotaxis sensory transducer
  KO
K03406  methyl-accepting chemotaxis protein
Organism
tid  Thermodesulfatator indicus
Pathway
tid02020  Two-component system
tid02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:tid00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Thein_0100
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Thein_0100
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:tid02035]
    Thein_0100
Bacterial motility proteins [BR:tid02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Thein_0100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal PilJ HAMP ZapD Matrilin_ccoil Vip3A_N PhageMin_Tail DUF1771 IFT57 BORCS8 FTCD_C
Motif
Other DBs
NCBI-ProteinID: AEH43985
UniProt: F8A8H5
Position
complement(97208..98707)
Genome map
AA seq 499 aa AA seqDB search
MKFDTIKARIQAIILVMFLLSILNAGMVFMVLQKNAGDAQYINLAGRQRMLVQKMTKEIL
SKDFASARNTANLFENSLQILKNGDRNKGLEPITDPKILAAWEDLHSCWQDFKKAFDRYL
ITGNKTDLNYLLDHNLKILSLANTLTKKFEEKAISNLNRLKIYQIAILSFTMFLLAAIWW
MARTKIIAPIDKAVALVMRVAEGDFTVKFPKTSKDEIGRLLAALEEMTERLRETLRNVVT
SSDQVYSSSQEIYRAGEEVAEKAVRLAQEGEEVKEAEKAINNSVRAVSAASEQMVEAITE
ISRNTSEAARIASEAETKAKETNDIVNKLGVSSEEIGEVISLIQSIAEQTNLLALNATIE
AARAGEAGKGFAVVAGEVKELSRQTTKATEKISRKIQAIQTDARASVKAIQEITEVISRI
NDISNMIASAVEEQTAMMGEISQAANMSAESAEQIREKIEKMSRAIKDTAEKGNKSRELS
QEMIALANRLKELASNFKV
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttgacactattaaggctcgtatccaggccatcattcttgtaatgttcctattg
agtatcctaaatgccggcatggtatttatggttttacaaaaaaatgctggagatgcccag
tatattaaccttgctgggcgccaaaggatgctggtgcaaaaaatgaccaaagaaatttta
tctaaagattttgcatcagctaggaacacagccaatctctttgaaaatagtctccaaatt
cttaaaaacggagatagaaacaaaggcttggagcctattactgatcctaaaatattggcg
gcttgggaagaccttcactcttgttggcaagatttcaaaaaagcttttgatcgttatctt
attaccggtaataaaacagaccttaattatctccttgatcacaatttaaaaattctttct
ttggccaataccctaaccaaaaaatttgaagaaaaggctatcagtaacctcaatagatta
aagatttatcagatagccatattgagttttaccatgtttttactggccgctatctggtgg
atggcaaggaccaagattattgctcccattgataaggctgtagctttagttatgagggta
gcagaaggggattttaccgttaagtttcccaaaactagtaaagacgaaataggaagatta
ctagccgcccttgaagaaatgaccgaacgtttgagagagaccttgagaaacgttgttacg
tcttcagatcaagtatattcgtcttctcaagaaatttaccgagccggagaagaagtagcc
gaaaaggccgtaagattggcccaagaaggagaggaagtaaaagaggcagaaaaggctata
aataatagtgtgcgagcagtttctgcggcttctgagcagatggtagaagccatcaccgag
atctctcgcaatacttctgaggcagcccgtattgccagtgaggcagagactaaggccaag
gaaactaacgatatagttaataaactaggtgtttcttctgaagaaataggagaggttata
agtcttatccagagtattgccgaacaaactaaccttttagccttaaacgccacgattgag
gcagcccgggctggagaggctggtaaaggctttgccgtagtagctggtgaggtaaaagag
ctttcacggcaaactactaaagctacagaaaagatatccagaaaaattcaagccattcag
acagatgctcgcgcttcagtaaaagctatccaagagattactgaagttataagtcgaata
aatgatatatcaaatatgatagccagtgctgtagaagaacagactgccatgatgggagag
ataagccaggcggccaatatgtctgctgaaagtgcagagcaaataagagaaaaaatagaa
aaaatgtcacgggctattaaagatacggcagaaaagggcaataaaagtcgagaactttct
caagaaatgatagccttagctaatcgtcttaaagaactagcttctaactttaaagtttaa

DBGET integrated database retrieval system