KEGG   Thermodesulfatator indicus: Thein_0102Help
Entry
Thein_0102        CDS       T01546                                 

Definition
(GenBank) ATPase-like, ParA/MinD
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ParA CbiA AAA_31 MipZ Fer4_NifH ArsA_ATPase Nitro_FeMo-Co AAA_26 RsgA_GTPase AAA_25 DUF2277 NB-ARC PhoH Desulfoferrod_N zinc_ribbon_2
Motif
Other DBs
NCBI-ProteinID: AEH43987
UniProt: F8A8H7
Position
complement(100377..101561)
Genome map
AA seq 394 aa AA seqDB search
MENVAKGMPGMDKSAIIEQQDRRVKEQLTRIRHKIMVMSGKGGVGKSSVAVNLAVGLSLQ
DFMVGLLDVDLHGPNVPKMLGLRRAHLPRRPDGRIGPVVYSPNLKFLSIEPLLPEEDSAI
IWRGPLKISAIKQFIGDIDWGKLDYLVIDAPPGTGDEPMTIAQTIPDAYALLVTTPQEVS
LIDVKKSYNFCKKVKMRILGLVENMSGFICPHCGKEVDLFKRGGGERLAEELGIKFLGRI
PVDPRVVAAGDSGKPMIAAFPESKTAEAFEELVRNVVAATEELLKDIEEGRFMRVAVPVE
GPLVTDKADEASMFAIYDVEKGVVKVKDVVPKPDDAPMDLWLKEQVITHLLTPQISKKLK
ESLTNMGVHVIENIPAKMKSDMAVQDLIAGVIKK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacgtagctaaaggtatgcctggaatggataaaagtgccataattgaacaacaa
gaccgccgtgtcaaagagcagcttaccaggatccgtcacaaaatcatggttatgtccggc
aagggcggggtaggaaaaagttcggtggcggttaacctggcggtaggcctttctttacag
gactttatggtcggcctcttagatgttgaccttcacggtccaaatgttcccaaaatgctt
ggtttaaggcgggctcatcttcctcgccgtcctgatggccgtatcggcccggtggtttat
tcgccaaacctcaagtttctctctattgagcctttacttcctgaagaagattcagccatc
atctggcgtgggccattaaagatttctgccatcaaacagttcatcggcgatattgactgg
ggaaaacttgattatctggtcatagacgcccctcctggcacaggtgacgaacccatgact
attgctcagactattcctgatgcttatgcccttttggtaactacaccccaggaagtttcc
ttgattgacgtaaaaaagtcttacaatttttgcaaaaaggtgaagatgcgcatcctgggg
ctggtggagaacatgagtggttttatttgccctcattgcggcaaggaagttgaccttttc
aagcgcggtggaggtgagcgtttagccgaagagcttggtattaaatttttaggtcgcatt
cccgttgacccaagagtagtagccgcaggcgattcaggtaaacccatgattgcggctttt
ccagagtccaaaaccgctgaggcctttgaggagctggtcagaaacgtggtagccgccact
gaagaactcttgaaagacattgaagaagggcgttttatgcgggtggctgttccggtggaa
ggtccactggtaactgataaagccgatgaggcctctatgtttgccatttacgacgtagaa
aaaggtgtcgtcaaagtgaaagacgtggttcccaaacctgatgatgctcccatggactta
tggcttaaagagcaggtgattactcatcttttaacgcctcaaatttctaagaaattaaaa
gaaagcctcactaacatgggagtccacgtgattgaaaatatcccggccaagatgaagtct
gacatggccgtgcaggacttgatagccggagtgattaaaaaataa

DBGET integrated database retrieval system