KEGG   Thermodesulfatator indicus: Thein_0104Help
Entry
Thein_0104        CDS       T01546                                 

Definition
(GenBank) protein of unknown function DUF224 cysteine-rich region domain protein
  KO
K11473  glycolate oxidase iron-sulfur subunit
Organism
tid  Thermodesulfatator indicus
Pathway
tid00630  Glyoxylate and dicarboxylate metabolism
tid01100  Metabolic pathways
tid01110  Biosynthesis of secondary metabolites
tid01120  Microbial metabolism in diverse environments
tid01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tid00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Thein_0104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCG Fer4_8 Fer4_17 Fer4_7 Fer4 Fer4_10 Fer4_9 Fer4_6 Fer4_16 Fer4_2 Fer4_4
Motif
Other DBs
NCBI-ProteinID: AEH43989
UniProt: F8A8H9
Position
complement(102045..103049)
Genome map
AA seq 334 aa AA seqDB search
MKPTELCARCGKCLVACPVFKATRRETFSPRGRLMALEEKKASFSFWASCLLCGACEKTC
PNNVPLLETLVKAKLAHPIPTRYLLAAADKLKPIASERFSIKKELVSLKGKKIAIFLGCG
GELLYPQAIKHLISLCPRPADLFVPQEQTCCGLPFLAAGDEKAFKEHLETNLKAFKQAEL
IITLCASCLFTLKKIYPAFTGDDGISAKTLDAMAYLAKNQDLEFSVPKEDIFFQVPCHLK
NLDTFPWWRDLGLLYYEGCCGQAGAFGYLFSKKAEQIRRPLFKEIEKSKPRYLATACTSC
LLALKKAFPTFPAKMVIEYLKTFIDPRFSLKREP
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaactgagctttgtgcccgttgtggtaaatgcctggtggcctgtcctgtgttt
aaggccaccagacgcgagaccttttctcccaggggaaggctaatggccctcgaggagaag
aaggcctcttttagtttttgggctagctgtcttttgtgcggtgcctgtgagaagacctgc
cctaataatgttccccttctggaaacactggttaaggccaagttagctcatcccatacct
acgcgatatttgctggccgcggctgataaattaaagccaatagcctcggaaaggttttct
attaaaaaagaactagtttctttaaagggaaagaaaatagctatttttctcggctgtggt
ggtgagcttctttatccacaggccataaagcacttaataagtttatgtccacggcctgct
gacctgtttgtgcctcaagaacaaacctgttgcgggcttcctttcctggcggcaggtgat
gagaaggcctttaaagaacacttagaaacaaaccttaaggcctttaagcaggctgagctt
attataaccctttgtgcttcctgcctttttactcttaaaaaaatttatcccgcgttcacc
ggagacgatgggatatcagccaaaactctggacgccatggcctatctggctaaaaatcag
gatttagagtttagtgtgcctaaagaagacattttttttcaggtgccctgtcatttgaaa
aatttagacaccttcccttggtggcgagatttaggccttctctactatgaaggctgttgc
ggccaggcaggggcttttggttatcttttctccaaaaaggccgagcaaataaggcggccc
ctttttaaagagattgaaaagagtaagccccgttacctggccacagcctgtacttcctgt
ttgctggcccttaaaaaggcgtttcctacttttcccgctaagatggtgatagagtatctg
aaaacttttattgacccaagattttcacttaagcgagaaccttag

DBGET integrated database retrieval system