KEGG   Thermodesulfatator indicus: Thein_0105Help
Entry
Thein_0105        CDS       T01546                                 

Definition
(GenBank) metal dependent phosphohydrolase
  KO
K07023  putative hydrolases of HD superfamily
Organism
tid  Thermodesulfatator indicus
Brite
KEGG Orthology (KO) [BR:tid00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    Thein_0105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD_3 HD HDOD
Motif
Other DBs
NCBI-ProteinID: AEH43990
UniProt: F8A8U3
Position
complement(103036..103608)
Genome map
AA seq 190 aa AA seqDB search
MFWHRLAKLLFEGAMLKRLERTGYAYLGTGKENIAAHSFGVSLAAMMLAKLVPEVDETKL
LKMAILHDFLEARTGDLNSVNKLYDRVDEEAAANDAFSGLPWEEEWQELLREYREAKTLE
AQLVHDADQLDLMVMLKEQHDLGNPYARRWLVYAKRRLRTDIGRKLAEAITETDWASWWL
DQFVAKDETN
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgttttggcacaggttagccaagctcctctttgaaggagctatgttgaaacgccttgaa
cgcacgggatatgcctatttggggacaggcaaagagaacatagcggcccattcctttggt
gtttccttggccgctatgatgcttgccaagctcgttccagaagttgacgaaactaaactg
cttaagatggccattttgcatgattttttagaggcacgcaccggggacctcaattcggta
aacaaactctatgacagagttgacgaagaggccgcggctaacgatgccttctctggtctt
ccttgggaggaagaatggcaggagcttttaagagaataccgcgaggccaagacccttgag
gcccaactagtccatgatgccgaccagctagacctcatggttatgctcaaggagcagcat
gacctgggaaacccttacgcccgccgctggctggtttacgccaaaagaaggcttcgtacc
gatattggccgtaaacttgcagaggccattaccgaaacagattgggcctcctggtggctt
gaccaatttgtggccaaagatgaaaccaactga

DBGET integrated database retrieval system