KEGG   Thermodesulfatator indicus: Thein_0106Help
Entry
Thein_0106        CDS       T01546                                 

Definition
(GenBank) ADP-ribosylation/Crystallin J1
  KO
K05521  ADP-ribosyl-[dinitrogen reductase] hydrolase [EC:3.2.2.24]
Organism
tid  Thermodesulfatator indicus
Brite
KEGG Orthology (KO) [BR:tid00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Thein_0106
Enzymes [BR:tid01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.24  ADP-ribosyl-[dinitrogen reductase] hydrolase
     Thein_0106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADP_ribosyl_GH
Motif
Other DBs
NCBI-ProteinID: AEH43991
UniProt: F8A8U4
Position
103876..104793
Genome map
AA seq 305 aa AA seqDB search
MTLRERYTGCLLGLAVGDALGAPLEFQARDLFEPVTDMIGGGPHFLEPGQWTDDTSMALC
LAESLIEKGGFDPHDQMERYCRWYEEGYLSSTGVCFDIGNTVKKALEKFRQTGNPFAGSK
DPWSAGNGCIMRLAPVPMFFYPDIEKAEWYAQESARTTHGAQECLDAARLFARMLIRALA
GKPKEEILLADSENFEASPKILDIARGAYFEKEEYEIRGTGYVVESLEAALWCFWQSESF
EEAVLMAINLGDDADTTGAVCGQIAGAYYGEKAIPERWLKKLTMAEKIRNTALKLLEAAT
RRSEK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgactttacgtgaacgatataccggttgccttttggggctggccgtgggagacgcctta
ggggctcctcttgagttccaggcaagagacctctttgagcctgtcacggacatgattggc
ggaggcccacatttccttgaacccggacagtggacagacgatacctccatggccctttgt
ctggccgaaagccttattgaaaaaggcggctttgaccctcacgaccagatggaacgttac
tgccgttggtacgaggaaggatatttgagcagcacaggggtgtgctttgacataggaaat
acggttaaaaaggcccttgaaaagtttcgccaaaccggaaacccctttgccggctcaaaa
gacccctggtctgctggtaacggctgcattatgcggctggctccagtgcctatgtttttc
tacccggacatagaaaaggccgaatggtacgcccaggaaagcgccagaaccacccacgga
gcccaagaatgcctggacgccgcgcgtctttttgctcgaatgctgataagagctcttgcc
gggaagcccaaagaagaaatccttcttgctgatagcgaaaattttgaagccagtcccaaa
attcttgatatagccagaggtgcctattttgaaaaagaagaatacgaaataagaggcacg
ggatacgtggtagaaagccttgaagccgctctctggtgtttctggcaaagtgagtccttt
gaagaggctgttttaatggccattaatcttggtgatgacgcagataccaccggtgccgtg
tgcgggcagattgctggtgcctattacggcgagaaggccatccctgaaagatggcttaaa
aagcttaccatggccgaaaaaatcagaaatacagccttaaaactccttgaagctgctaca
agaagaagtgaaaagtga

DBGET integrated database retrieval system