KEGG   Thermodesulfatator indicus: Thein_0107Help
Entry
Thein_0107        CDS       T01546                                 

Definition
(GenBank) helicase domain protein
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNF2_N Helicase_C ResIII PLDc_2 DEAD AAA DUF2075
Motif
Other DBs
NCBI-ProteinID: AEH43992
UniProt: F8A8U5
Position
complement(104885..108133)
Genome map
AA seq 1082 aa AA seqDB search
MEKLKQISIFERVEERVWPSVEFFPLNTPYQKIENIVREDILSSSRYTIVTGYSSLEYLI
SFFGEGHFPNRKITVVLGHELDLPEEQLKAPWPKVNLSQEIKEYWLEKGISVTLSGALLN
FLEELKARNIVFRLGRELHAKVYLGDTHAILGSSNFSRAGFVFQKEANIRLSATDPRYED
LKLIVSNFVKDSQDYQEEIIALLEQLLRYVSWQEVLAYAICQIMGDEWLTQHEGLSRVLA
RLKLWPSQRQAVAQALWVLDNHGSVLIADPTGAGKTKVGLAVLTALSFRFLSRQELRRLS
SYVICPPGVKDQWEEEALSEDIPFVPEAISQGLLSVSHGEARSRALEKIRRANILLIDEA
HNYLSRTSRRSQSIQLNSLAEHVILMTATPINRGVEDLLRLMEVLGLDNLSEEGLETYQK
LRREIETTGKFSRDQLEKLRRYVQLFTVRRTKQELNRLIEEKPEEYRDKFGRLCRFPKEI
SKLYPTGETQRDRELALKIDELSRELKGLVWLRKTIFDLWQNENAFDANFLSKRLSAAPA
LARFNVKAMLRSSRVALVEHIEGTEAAQRAFGLSGKFKHATGDILSALADWKLKAKELFR
PLPETAEAPLWLKSKEAFLEALDQEMKIYGRIASLCREISPAREETKARFVLELFKKHKL
ILAYDSRLITLAYLEGLVKRLDPEIKILFVTGGRPKERRLLKRFFSLGSPAKNVLALCSD
AVAEGVNLQQAGAVVFFDLPSVIRLAEQRIGRIERLDSPHEEVEIYWPNDSQEFCVSTDR
RLVERHLLVENILGSNINIPEEFLEYAQGYQEEKITGRMMLELFEQKRKEFEASFWDGLA
DAFQPVKKLMEGENPLVPEKTFREIKGLKIKGSLVSAVKAKRPWCFLCLKGSKKANTAPS
WVFLEKGKEPITDISEICQKLRENLTPDEASIPWLKGADELLQSFLEDLKRAEFLLLPAR
HKRALKVFQEILRYYHRRDRGHERRAVVARLLYLIENYREENLDLYHFSRLCLELLVPKL
QEFIKTTQKRGPFLLKDLKTYLRENPLTTEELKSLLANVKTKDPVEKMIAACLLGLPEES
KE
NT seq 3249 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaactaaaacagatttctatttttgagcgcgttgaagagcgtgtctggccatcg
gtagaattttttcccttgaatactccttatcaaaaaatagaaaacattgtccgtgaagat
attctctcttcaagtcgctataccatcgttaccggctattcttctcttgaataccttatt
tcgttctttggcgagggtcatttccctaaccgcaagattaccgtggtgttaggccacgag
cttgatctccctgaagagcagttaaaggctccctggcccaaagttaacctctctcaggag
ataaaggaatactggcttgaaaagggtatctctgtaacccttagtggtgctcttctcaat
tttctcgaagagttaaaggcgagaaatattgtctttcgcctgggccgagagcttcacgcc
aaggtctatctgggagatacccatgctattttgggctcaagcaatttttcccgggctggc
tttgtttttcaaaaagaggccaatattcgcctctcagccacagacccacgctacgaagac
ttaaagcttattgtctcaaactttgttaaagacagtcaggattaccaggaggagataata
gcccttctagagcagcttttgcgctacgtaagctggcaggaggtgctggcctatgccatt
tgccagataatgggcgacgaatggcttactcagcacgagggtttaagccgggtgcttgcc
aggctaaagctttggccttcccagcggcaggccgtggctcaggccctatgggtgcttgat
aaccacggaagtgtgctcattgctgaccccaccggcgccgggaagaccaaagtagggctt
gcggtgcttacggcgctaagtttcaggtttctttcccggcaggagttaagacgcctttca
agctacgtaatctgcccacctggtgttaaagaccagtgggaagaagaggctttaagcgaa
gacattccctttgtgccagaggccatttctcaggggctattaagtgtgtcacacggtgag
gccagaagccgtgcccttgaaaagattaggcgggccaatatcctcctcatcgacgaagcc
cataattacctttcccgtacttccaggcgttcgcagagtatccagttaaacagcctggct
gaacacgtaatcctcatgaccgccacgcccataaatcgcggcgtggaagacctcctgcgt
ttaatggaagtccttggccttgataacctttctgaagagggccttgagacctatcagaaa
ctaagacgtgagattgaaaccaccgggaaattttctcgtgatcagctggaaaagcttagg
cgttatgttcagctctttaccgtgcggcgcaccaaacaggagttaaaccgtctcattgaa
gaaaaaccagaggaatatcgtgacaaatttgggcgtctctgccgtttcccgaaagaaatt
agcaaactttaccctacaggagaaacccaacgcgaccgcgagttagctcttaagattgac
gagctttcgcgggaactcaaaggccttgtctggttgcgaaaaactatctttgatctctgg
caaaacgaaaacgcctttgacgctaattttttaagtaaaaggctttctgcagccccggcc
ctggcccggtttaatgtcaaggccatgctgcgctcctcaagagtggctctcgtggagcac
attgaaggcactgaagccgcccaaagggcctttgggcttagcggcaagttcaagcacgcc
actggcgacattctaagtgccctggctgactggaagcttaaagccaaggagcttttcagg
cctttgccggagactgctgaagcgcctctctggcttaaaagcaaagaggcctttcttgag
gcccttgaccaggagatgaaaatctatggccggatagccagtctttgtcgggaaatatcc
cctgctcgcgaagaaaccaaggcccgctttgtacttgagcttttcaaaaaacacaaactt
attctggcttatgacagccgtttaatcacgctggcctatctggaaggccttgtaaagagg
cttgacccggagataaagatacttttcgttaccgggggaaggccaaaggaaagacgcctc
cttaagcgcttcttttctctggggtcgccggccaagaatgtgcttgccctttgttctgac
gcggtggctgaaggtgtaaaccttcagcaggcaggagcggtggtgttttttgatctacct
tcggttataaggcttgctgagcaacgcatcggccgtattgagcgccttgatagccctcac
gaagaagttgaaatttactggccaaatgactcgcaagaattctgtgtttccactgacagg
cgtcttgttgagcgccacctgctagtggaaaacatactgggaagcaatatcaacatccct
gaagagtttctggaatacgcccagggctatcaggaagaaaagattaccgggcgcatgatg
cttgagctttttgaacaaaaaagaaaggaatttgaggccagtttttgggacgggctggct
gatgcctttcaaccggtcaaaaaacttatggaaggtgaaaacccattagtacctgaaaag
acttttagagagataaagggcctcaagataaagggttcgttggttagcgcggtaaaggcc
aaaaggccgtggtgctttttgtgtctcaaaggttcaaagaaggctaataccgcgccttca
tgggttttccttgaaaaagggaaagaaccgataactgatatttcagaaatttgtcagaaa
ctacgagagaatttaacccctgacgaggcttctatcccctggttaaaaggggctgatgag
cttttgcagagctttcttgaagacctcaaaagggcagaatttttactattgccggccaga
cataagcgggctttaaaggtcttccaagaaattttaaggtattaccaccgcagggatagg
ggccacgaaagaagggccgtggtggcgcgccttctttatttgattgaaaactaccgcgaa
gaaaaccttgacctctatcacttctcccgcctgtgccttgagcttctggtgccaaaactt
caggaattcataaaaacgacccagaaaagaggcccttttctcctaaaagacctgaaaaca
tacttgcgagaaaaccctctgaccacagaagaactaaagagccttttggcaaacgtgaag
accaaagacccggtagaaaagatgatagccgcctgcctcctaggcttaccagaagaaagt
aaggagtga

DBGET integrated database retrieval system