KEGG   Thermodesulfatator indicus: Thein_0108Help
Entry
Thein_0108        CDS       T01546                                 

Definition
(GenBank) Trans-aconitate 2-methyltransferase
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_12 MTS Ubie_methyltran PCMT PrmA Methyltransf_9 Methyltransf_4 DREV Methyltransf_2 CMAS NodS FtsJ RrnaAD DOT1 TehB MetW Methyltransf_32 Methyltransf_18 GidB Methyltr_RsmB-F Fibrillarin Methyltransf_5 DUF938 UPF0020
Motif
Other DBs
NCBI-ProteinID: AEH43993
UniProt: F8A8U6
Position
108341..109132
Genome map
AA seq 263 aa AA seqDB search
MSYKWNPEEYRISSSNQKRWGQELLSKIDFKGDEKVLDIGCGDGEITALIAQRVPKGFVV
GIDSSKDMINMAKKNFLSKEYPNLSFLVKDVREITFEKEFDIVFSNACLHWVIDHLSVLK
RIKTSLKPSGKIFFQMGGKGNAEEIIKVLENIIRQPKWSKFFKNFSFPYGFYSPKEYSKW
LKIAGFKPKRIELLTKDMIHQDEKTFASWLLSTWLPYLQRIPENNREEFISEVIKRYLEK
HPQDKNGCIHVQMVRLEVEAEIH
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagttacaaatggaatcctgaagaatatcgcattagctcttcgaatcaaaaaagatgg
ggtcaagaactactttcaaaaattgattttaaaggcgatgaaaaagttttagatattggt
tgcggagacggagaaataacagcccttattgcccagagagttcccaaaggatttgttgta
ggaattgatagctcaaaagatatgataaacatggctaagaaaaattttttgtcaaaagaa
tatccaaatctcagttttttggtaaaagatgtaagagaaatcacttttgagaaggaattt
gatatcgtattttcaaatgcttgtctacattgggtaatagatcacctttctgtccttaaa
agaataaaaacaagtttaaaaccttctggaaaaatcttttttcaaatgggtggtaaggga
aatgcagaagaaattataaaggtcttagaaaatattataagacaaccaaagtggtctaaa
ttttttaaaaatttctcatttccttatggtttttatagccctaaagaatacagtaaatgg
ctaaagatagctggctttaaaccaaaaaggattgagctattaacaaaagatatgattcat
caagacgagaaaacttttgcttcatggctcctctctacctggcttccttacctccaaaga
attcctgaaaataatagagaagagtttataagcgaggtgataaaaagatatcttgaaaaa
caccctcaagacaaaaacgggtgtattcatgttcaaatggtaagattagaagtcgaagcc
gaaatacactaa

DBGET integrated database retrieval system