KEGG   Thermodesulfatator indicus: Thein_0109Help
Entry
Thein_0109        CDS       T01546                                 

Definition
(GenBank) hypothetical protein
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEH43994
UniProt: F8A8U7
Position
109438..109989
Genome map
AA seq 183 aa AA seqDB search
MAYEHWKKFVVGSLVGAVAFASAYILPAKKARAEDRIFAAVSFPLSRDFLKGARVEGGFA
HLDDNTGYSAELFVAPFQKTIGVGADLYAGTEDLGGSLGAELGYNIPNHSIQEALRARIE
ALKGATNLGVRLPLDGIKPKLSGLELTIGGGTQKWVEDKKEDPATTSSSNSATPTGPPIS
GDF
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggcatatgaacattggaaaaaattcgttgttgggtctttggtaggtgctgttgcattt
gcaagtgcttacatcttgcctgctaaaaaggcaagggctgaagacaggatatttgctgcg
gttagctttccgttaagcagggatttccttaaaggtgcaagggttgaaggcggctttgcg
catcttgatgacaacacaggttacagtgctgaactattcgtagcaccttttcagaaaaca
atcggagtaggtgctgacttatacgctggaacagaagaccttggcggctctttaggtgca
gaacttggctacaacataccaaaccatagcattcaagaagcactaagggcaagaattgaa
gctctcaaaggagcaacaaacctcggcgttagattacctttagacggcattaagccaaag
ctttccgggttagaacttaccataggtggtggcactcaaaaatgggttgaagataaaaaa
gaagaccctgctactacaagcagcagcaattctgctactcctactggcccacctattagt
ggcgatttttaa

DBGET integrated database retrieval system