KEGG   Thermodesulfatator indicus: Thein_0127Help
Entry
Thein_0127        CDS       T01546                                 

Definition
(GenBank) RimK domain protein ATP-grasp
  KO
K05844  ribosomal protein S6--L-glutamate ligase [EC:6.3.2.-]
Organism
tid  Thermodesulfatator indicus
Brite
KEGG Orthology (KO) [BR:tid00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:tid03009]
    Thein_0127
Enzymes [BR:tid01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.-  
     Thein_0127
Ribosome biogenesis [BR:tid03009]
 Prokaryotic Type
  ribosomal protein modification factors
   Thein_0127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RimK ATP-grasp_4 Synapsin_C ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AEH44012
UniProt: F8A8W5
Position
127381..128217
Genome map
AA seq 278 aa AA seqDB search
MADELNISTHPSGPIISFHPLVKADYNFWAFSAINDELLSYLYRANIVIWPQVFPSQLYF
YACQKGLRSFPNYDIRFKFPGKSGQMLLFKALDLPYPNTIFFPKIAALGSHPNAIKVKIF
SYPFVLKTDDEHEGQGVFLIENESAWQRALARIKQREREGKFGFLMQEFLPVPYDLRVVV
IGREFFPFWRALGPNFKANLAQGGKAIPCPDKTLEKKALELTKTLCFKTDINLAAIDFLI
HPEDSLLLNEINFVFGRRLLGKSFNKLFFKAIKDFIDS
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgaattaaatataagcactcacccgagcgggccaataatttcttttcatcct
ttagtgaaggcagactataatttttgggccttttcggccataaatgacgaattactttca
tatctttaccgggccaatatagttatctggccccaagtctttccttctcaactctacttt
tacgcttgccaaaaggggttacgcagcttccctaattacgatatacggttcaagtttcct
ggtaaaagtggccagatgttgctttttaaggcccttgatcttccttatccaaacaccatc
tttttcccaaaaattgcggccctcggatcccacccaaacgctattaaggttaaaattttt
tcttatccctttgtcctcaaaactgatgacgaacatgaaggccaaggtgtttttcttata
gaaaatgaaagcgcctggcaaagagcccttgctcgcataaaacagcgggaaagagaaggt
aagtttggtttcctaatgcaagaatttttgcctgtcccctatgacctgcgcgtggtggtg
ataggccgtgaattttttccattctggagggcacttgggcctaattttaaagccaattta
gcccaggggggcaaggctatcccttgcccagataagactcttgaaaaaaaggccctcgaa
cttaccaaaacgctttgttttaaaaccgacatcaatctggcggctattgatttcctgatt
caccccgaagacagcctacttttaaatgagataaattttgtatttgggaggcgactattg
ggaaaatcattcaataaattgttttttaaagccataaaggactttattgactcttaa

DBGET integrated database retrieval system