KEGG   Thermodesulfatator indicus: Thein_0131Help
Entry
Thein_0131        CDS       T01546                                 

Definition
(GenBank) molybdenum cofactor biosynthesis protein A
  KO
K03639  GTP 3',8-cyclase [EC:4.1.99.22]
Organism
tid  Thermodesulfatator indicus
Pathway
tid00790  Folate biosynthesis
tid01100  Metabolic pathways
tid04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:tid00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Thein_0131
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    Thein_0131
Enzymes [BR:tid01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.22  GTP 3',8-cyclase
     Thein_0131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mob_synth_C Radical_SAM Fer4_14 Fer4_12
Motif
Other DBs
NCBI-ProteinID: AEH44016
UniProt: F8A8W9
Position
complement(130712..131683)
Genome map
AA seq 323 aa AA seqDB search
MLIDSYGRKITYLRVSVTDRCNLRCFYCSSKDSFAKLPPEKILSYEELYQIIKVAVSLGV
KRVRLTGGEPLVRKDLVSFVAALAQIPGLEDLALTTNGILFASMALDLKKAGLKRVNISL
DAITPQKYKEICGIDALNQVLAGIEKALEVGFSPVKINMVVMRGLNDDEAIEMARLTLKE
PLEVRFIEFMPIGSGAPWEEDLFMPVSEIEKRLKEVFGELHPASKIGAGPAKVFTLPGAK
GSVGFISAISNHFCHKCNRLRLTPEGRLRLCLFSDEEIDLRPFLNQKNPQEALKEAFLKA
IQRKPSQRSLDTSPKRLMRSIGG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgcttatagattcttatggccgaaaaataacttatcttcgcgtttccgttacagaccgc
tgtaatttacgctgtttttattgttcaagtaaagattcctttgccaaactacccccggaa
aagattctttcttacgaggaactttatcaaattattaaggtagcggtatctttaggggtc
aaaagggtacgtcttaccggtggagaacccttagtacgcaaggacttagtttcatttgta
gcggcgctggcccaaattccaggtcttgaagatctggccttaaccacaaacggtatccta
tttgcctctatggccttagaccttaaaaaggcaggtcttaaacgggttaatataagctta
gacgccattactcctcaaaagtacaaagaaatttgcgggatagacgctttaaaccaagtt
ttggcgggaatcgaaaaggctttagaagtaggtttttccccggtgaaaatcaacatggtg
gttatgcgggggctaaacgatgacgaagccattgaaatggcccgtttgacccttaaagag
cctcttgaagtcaggtttatagaatttatgcccattggctcaggggcaccgtgggaagaa
gatctttttatgcctgtttcagaaatagaaaaaaggcttaaagaagtatttggtgagctg
cacccggcctctaaaataggggcaggtccagctaaagtatttactctccctggcgctaaa
ggcagtgtaggttttatttcagctataagtaatcatttttgtcataagtgtaatcgcttg
cgtttaacccctgaaggtcgtttgcgtctctgtctcttttctgacgaagaaatcgacttg
agaccatttttaaaccaaaagaatcctcaagaggctcttaaagaagcctttttaaaggct
attcaaagaaagccgtcccagagatctcttgacacatctcctaaaaggcttatgcgaagt
ataggaggttaa

DBGET integrated database retrieval system