KEGG   Thermodesulfatator indicus: Thein_0135Help
Entry
Thein_0135        CDS       T01546                                 

Definition
(GenBank) Cupin 2 conserved barrel domain protein
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 AraC_binding Ectoine_synth Auxin_BP Cupin_7
Motif
Other DBs
NCBI-ProteinID: AEH44020
UniProt: F8A8X3
Position
complement(135726..136040)
Genome map
AA seq 104 aa AA seqDB search
MKVFNLDETRVFDKALNKFLVHDSPYFRIINFNIKAGEEFPVHSHSVEGELSILVLEGEG
YFLGAEGAKTPAKAGDIFICAINEPHGVEAKTDMRILVAIAPPL
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtatttaatcttgacgagacccgtgtatttgacaaggcccttaacaaatttttg
gttcatgattctccgtattttcggatcattaatttcaatataaaagccggtgaagagttt
cctgtgcattcgcattcggttgagggagagttaagcattcttgttttggaaggtgaaggc
tattttctaggggccgaaggagccaaaactccggctaaggctggcgacatttttatttgt
gccataaatgaacctcacggtgtggaagccaaaactgacatgcgtatcctcgtagccatt
gctccgccactataa

DBGET integrated database retrieval system