KEGG   Thermodesulfatator indicus: Thein_0138Help
Entry
Thein_0138        CDS       T01546                                 

Definition
(GenBank) regulatory protein TetR
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1956 TetR_N DUF4070
Motif
Other DBs
NCBI-ProteinID: AEH44023
UniProt: F8A8X6
Position
complement(138436..139071)
Genome map
AA seq 211 aa AA seqDB search
MKNKFSDKFGTKERLIEVAERLFAEKGFKGVSVREITSQAKVHLGAINYYFGSKEGLYLE
VFQTRFLERAKRLKETFEKNLKDDDPNLEGVIRAFAKAIISGPLTEEEREIHFKLLAREM
VRPSSILKLIVEEALNPFLVSFEEALKIYLPSLPPEKMRMAVLSILAQILYFNFARPKVQ
EVTGQKFDAHFEKFLIEHVVSFSLKGIEGLA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataaattttcggataaattcggcaccaaagaaaggctcattgaggtggctgag
agactttttgccgaaaaggggtttaagggggtgagtgtgcgagagataaccagccaggcc
aaagtacacctcggggctataaattactactttggttctaaagaaggtctttatcttgaa
gttttccaaactcgttttttagaacgggccaaacgccttaaagaaacctttgaaaaaaat
ctcaaggatgatgaccctaacttagaaggagtgattagagcttttgctaaagccataatt
tccgggccactaacagaagaagaacgtgaaattcactttaaacttctggcaagggagatg
gttaggccgtctagtattttaaaacttatcgtggaagaagcgttaaatccttttctagtc
tcttttgaagaagcactaaaaatttacttgccttctcttcctcctgaaaaaatgcgcatg
gccgtgcttagcattctagctcagattctttatttcaatttcgctcgccccaaggtgcaa
gaagttaccggccaaaagtttgatgctcactttgaaaagtttttgatagagcatgttgtt
tctttttctctcaagggcatcgagggcttggcatga

DBGET integrated database retrieval system