KEGG   Thermodesulfatator indicus: Thein_0142Help
Entry
Thein_0142        CDS       T01546                                 

Definition
(GenBank) Orn/DAP/Arg decarboxylase 2
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Organism
tid  Thermodesulfatator indicus
Pathway
tid00300  Lysine biosynthesis
tid01100  Metabolic pathways
tid01110  Biosynthesis of secondary metabolites
tid01120  Microbial metabolism in diverse environments
tid01130  Biosynthesis of antibiotics
tid01230  Biosynthesis of amino acids
Module
tid_M00527  Lysine biosynthesis, DAP aminotransferase pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:tid00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Thein_0142
Enzymes [BR:tid01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.20  diaminopimelate decarboxylase
     Thein_0142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Orn_Arg_deC_N Orn_DAP_Arg_deC Ala_racemase_N
Motif
Other DBs
NCBI-ProteinID: AEH44027
UniProt: F8A8Y0
Position
complement(142973..144325)
Genome map
AA seq 450 aa AA seqDB search
MKEPYEKPLIKKVQVGLSNKFGSVYGRHLRPEIDGVPISDLVSRFGSPLFVFSERRLREK
YRQIYQMFSTRYPNVQFSWSYKTNYLDAICAILHQEGETAEVVSEFEYEKARRLGVPGSE
IIFNGPYKPLSALKTAVQEGAIINIDHFDEIYDLEEIAEELGQPIKVGIRLNMDTGISPQ
WTRFGFNLESGQALDAAKRLVSGGKLILNGLHCHLGTFLLEPRAYAKAIEKMVDFAYELE
DNFDLKIEYLDIGGGFPSRNRLKGIYLSPEVAVPPLEDFAEAICDTLLSKLKPNDFPKLI
LETGRAIVDEAGFLITTVHASKRLPDGTRSYVVDAGVNILFTAFWYNFKIELEEDISGPA
EPCVIYGPLCMNIDVVAENVQLPPLPRGTRLIFSPVGAYNVTQWMQFIRYRPAVVLVGED
GQVDVIREAENLNDVVDRERLPERLILKKS
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaccttacgaaaagccactcataaaaaaggttcaagtaggacttagcaataaa
tttggttctgtttatggtcgccatttgcgtccagaaatagacggagtacctattagcgac
ttggtttctagatttggctctcctctttttgttttttctgaaaggcgattaagagagaaa
tatcgtcaaatttatcaaatgttttctacgagatacccaaatgtccagttttcctggtct
tataaaactaattatctagatgctatttgtgccatcctacatcaggaaggagagacagca
gaggttgtctcggagtttgaatatgaaaaggctcgcagattaggtgttcctggttctgaa
ataatttttaatggtccatacaagcccttatcagcccttaagacagcggttcaggaagga
gcgattataaatattgaccattttgacgagatttatgatttagaagaaattgccgaggaa
ttgggacagcctatcaaagtaggtattcgcctgaatatggatacggggataagtcctcag
tggacgcgttttggttttaatctggaatcaggccaggctttagatgctgctaaaaggtta
gtttcaggtggtaaactgatattaaatggcctacattgtcatttgggtacttttttgctt
gagcctagagcgtatgccaaagctatagaaaagatggtagatttcgcttatgaacttgaa
gataattttgacttaaaaatagaatatttagacatcggaggcggattcccttctcgtaat
cggttgaaaggaatttatttgtcaccagaagtggctgttcctcctttagaagattttgcc
gaagctatttgtgatactttgttatcaaaacttaaacctaatgactttcctaaacttatt
ttagaaacaggtagagctatagtagatgaagctggttttttgattactactgtacatgct
agcaaacgcttgccagatggtactcgttcttatgtagtagatgctggagttaatattctt
tttacagcattttggtataattttaaaatagaacttgaagaagatatttcgggcccagca
gaaccctgtgtaatttatggccccctttgtatgaatatagatgtagttgccgaaaatgtc
cagttacctcctttacctagaggtacccgtcttattttttctcctgttggagcttataac
gttactcaatggatgcaatttattcgttatcgtccggcggtagttctagtaggggaggac
ggccaagttgacgttattagagaagctgaaaacttaaatgatgtagtagatagagaacgt
cttcccgaaaggcttatattaaaaaagtcctag

DBGET integrated database retrieval system