KEGG   Thermodesulfatator indicus: Thein_0143Help
Entry
Thein_0143        CDS       T01546                                 

Definition
(GenBank) hypothetical protein
  KO
K01955  carbamoyl-phosphate synthase large subunit [EC:6.3.5.5]
Organism
tid  Thermodesulfatator indicus
Pathway
tid00240  Pyrimidine metabolism
tid00250  Alanine, aspartate and glutamate metabolism
tid01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tid00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Thein_0143
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Thein_0143
Enzymes [BR:tid01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     Thein_0143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATPgrasp_Ter ATP-grasp_3 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AEH44028
UniProt: F8A8Y1
Position
complement(144343..145383)
Genome map
AA seq 346 aa AA seqDB search
MSEEIVVAVSGINAVDNPGPGLGVIRSLKEDSSLTIKALGLAYDAMEPGIYLDWLVDKSF
IMPYPSSAEEDYLARLFYIQDVTGLQVVIPTLDAELPLFIKGEQELSSRGIKTFLPTWEQ
FELRSKQRLMEMAPRLGLSVPPTEQVSSYSDLMKALDRIGFPAMIKGLFYKAYRVHTFAE
AEGVFYKIVEEWGYPVLVQKVIQGEELNVVGVGDGEGGSLGMMAIKKLWITSLGKIWTGV
TIKHDVLLESSQKFLRETGWRGAFELECIATEDRIYLIEINPRFPAWLYFATGAGINLPA
RMVKKVLGQPVETHSEYEAGRLYIRYTYDLVTDMDVFQKIVTRGET
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagaaatagtagtggccgtttcaggcattaacgctgttgataatccaggcccg
ggtttaggggtcatcagaagtttaaaagaagactcttctctaacaataaaggccttaggc
ctggcttatgatgctatggagccaggaatatatcttgattggctggttgataaatctttt
attatgccctatccctcaagcgctgaagaagattatttggccagacttttttatattcaa
gatgttactggtcttcaggtggtaattcccaccttagatgctgagcttccccttttcatt
aaaggggaacaggaattgtcatctagagggatcaagacctttcttcctacctgggaacaa
tttgagctacgttctaaacagcgattaatggaaatggcccctcgccttggcctgtctgtt
cctccaacagaacaagtctcttcatattcagacctcatgaaagcgcttgatcgcataggc
tttcccgctatgataaaaggccttttttataaggcttatcgggtgcacacttttgccgaa
gccgaaggagttttctataaaatcgtagaagaatggggatatccggttctggttcaaaaa
gtcattcaaggtgaggaattaaatgtagtaggtgtaggcgatggagaaggtggttcttta
ggtatgatggccatcaaaaaactctggatcacttctcttggcaagatatggacaggagta
accataaaacatgatgttttacttgagtcatcgcagaagtttttgcgtgaaactggctgg
cgaggagcttttgaacttgaatgtatagccactgaggatcgtatttatctgattgagata
aaccctcgttttccagcttggttatactttgccactggagcgggtattaatcttccagca
agaatggtcaaaaaggtattaggtcaacctgttgagacccattctgaatacgaagctggg
cgtctttatatacgttacacttacgatttggttactgatatggatgttttccagaaaata
gtaacgcgtggtgaaacttaa

DBGET integrated database retrieval system