KEGG   Thermodesulfatator indicus: Thein_0146Help
Entry
Thein_0146        CDS       T01546                                 

Definition
(GenBank) signal peptide peptidase SppA, 36K type
  KO
K04773  protease IV [EC:3.4.21.-]
Organism
tid  Thermodesulfatator indicus
Brite
KEGG Orthology (KO) [BR:tid00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tid01002]
    Thein_0146
Enzymes [BR:tid01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     Thein_0146
Peptidases [BR:tid01002]
 Serine Peptidases
  Family S49: protease IV family
   Thein_0146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S49 CLP_protease SDH_sah OppC_N SfLAP
Motif
Other DBs
NCBI-ProteinID: AEH44031
UniProt: F8A8Y4
Position
147677..148552
Genome map
AA seq 291 aa AA seqDB search
MSVRKFFTNLLAFLGGIFLFFLILFAISLFLLFKGEPTFSSGPKIGLIEIKGVISEADKP
LKEIRQFARNKHIKAVVVRIESPGGAVGASQELYLALRELSKEKPVVASMGSVAASGGLY
VALGAQKIVAAPGTITGSIGVMMQVPNLSKLLEKIGIEATILKSGPYKDTGNMFRPLRED
EKKILYQTINDIYQQFVKAIEDSRGLKEAEIKKFADGRVFTGRAAKEFGLVDELGNLNDA
IKLAAKMAGLKGYPEVVYPSKEKLWERFLVEQKLSQSLAVLFSPLYIMKWQ
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttcgaaaattttttacaaatcttttagcctttttaggcggaattttccttttt
ttcttgattttgtttgctataagcctttttcttttatttaaaggagaacctaccttttct
tctgggcctaaaatagggttaattgaaataaaaggggttatctcggaggcagataaacct
ttaaaagaaatcaggcagtttgcacgaaacaaacacataaaggccgtagtagtacgtatt
gaaagccccgggggagcggtgggagcctctcaggaactctatcttgcccttagagaactc
tctaaagaaaagcctgtagtagcctctatgggctcggtagcggcctcaggggggctttat
gtagctcttggagcccaaaaaatagtagccgctccaggcaccataacaggaagtatcggg
gttatgatgcaagtccctaacctcagcaagcttttagaaaagattggcattgaagccact
attctaaaaagtggtccctataaagacactggcaatatgtttcggcctttaagagaagat
gaaaaaaaaatcctatatcaaactattaatgatatttatcagcagtttgtaaaggccata
gaagactcgagaggtcttaaagaagctgaaatcaaaaagttcgcagatgggcgcgttttt
accggtcgggctgctaaagaatttggcctagtagatgaacttggaaacttaaacgatgcc
atcaaactagctgctaaaatggctggcctgaagggttatccagaagtagtctatccttct
aaagaaaaattatgggaacgctttctagtagaacaaaaacttagtcaaagtttggctgtt
ctcttttctcctctttatataatgaagtggcagtaa

DBGET integrated database retrieval system