KEGG   Thermodesulfatator indicus: Thein_0149Help
Entry
Thein_0149        CDS       T01546                                 

Definition
(GenBank) Type II secretion system F domain protein
  KO
K02653  type IV pilus assembly protein PilC
Organism
tid  Thermodesulfatator indicus
Brite
Secretion system [BR:tid02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   Thein_0149
Bacterial motility proteins [BR:tid02035]
 Pilus system
  Pilus assembly proteins
   Thein_0149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T2SSF DUF4199 ATP-synt_J
Motif
Other DBs
NCBI-ProteinID: AEH44034
UniProt: F8A8Y7
Position
151452..152660
Genome map
AA seq 402 aa AA seqDB search
MPVYEWVGKNPAGEIVKGTLEAPDEKIVRIKLRRQKITPVKVKAKGSGFLARLSTPKKVK
AKEIVVFTRQLAAMLEAGLPLIQALDSLAHQQKNPYFKEVVFKIKKAVEEGTPFSEALKQ
YPKIFDKFYFHMIEAGESSGNLELSLKRLATYMEKNLALKAKVKKAMIYPSIVLFVTVVV
LSIIMLFVVPTFEKMFSEMGKALPLPTQIVIEASRLTKTYFPFFIGGTIISVFLLRQYYR
TEKGRLHIDALLLKLPLFGNLFRKVAVARFSRTLSTLIMSGVSIIDALTIAAKTAGNVVV
ERTINQVRQAVQEGQSIADPLSKSSIFPYMVVQMVTVGEASGTLEKMLDKVAEFFEEEVD
NTVDAMAQMIEPVMIVFLGVVIGGIIVSLYLPIFKLGEVVAG
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgccagtatatgaatgggtggggaaaaatcctgctggagaaatagtaaaaggaaccctt
gaagccccggacgaaaagatagtccgcatcaaattaagacgtcaaaaaataactccagta
aaagtaaaggccaaaggctcaggctttttagcacgtctcagcacccctaagaaagtaaaa
gcaaaagaaatagttgttttcaccagacagcttgccgccatgcttgaagccgggcttcct
ttgattcaggcccttgattcgcttgcccaccaacaaaaaaacccctatttcaaagaagta
gtttttaaaatcaaaaaagcggtagaagaaggaacacctttttctgaagcccttaaacag
taccccaaaatatttgataaattctattttcatatgatagaagccggcgaaagcagtgga
aatttagaactttctctgaaaagactggccacttacatggaaaaaaatctggcccttaaa
gccaaagttaaaaaagccatgatttatccttctattgtgctctttgttactgtagtagtt
ttgagcataatcatgcttttcgtagtccctacctttgaaaaaatgttttcagaaatgggt
aaggccctccccttgcctactcaaattgttattgaggccagccgtctcactaaaacttat
ttcccctttttcataggaggaactattatttccgtatttcttttgagacaatactaccgt
acagaaaaaggccggctacatatagatgccctgcttcttaagcttccacttttcggaaat
ctctttcgcaaagtagccgttgctcgcttttcgcgaactttgagtaccttgataatgagt
ggcgtctctataattgacgccttaaccattgccgccaaaaccgctggaaacgtagtagta
gaaaggaccatcaatcaagtacggcaagctgttcaagagggacaatcaattgctgaccct
ctttctaaaagcagtattttcccttatatggtagtacaaatggtaaccgtaggtgaagct
agtggtactcttgaaaaaatgcttgataaagtagctgaattttttgaagaagaagtggac
aatactgttgatgccatggcccagatgattgaaccggtaatgatcgtgtttttaggagtg
gtaatcgggggaattattgtctcactttatcttcctatcttcaaactcggagaagtagta
gctggataa

DBGET integrated database retrieval system