KEGG   Thermodesulfatator indicus: Thein_0153Help
Entry
Thein_0153        CDS       T01546                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tid  Thermodesulfatator indicus
Pathway
tid00010  Glycolysis / Gluconeogenesis
tid00620  Pyruvate metabolism
tid00640  Propanoate metabolism
tid00680  Methane metabolism
tid01100  Metabolic pathways
tid01110  Biosynthesis of secondary metabolites
tid01120  Microbial metabolism in diverse environments
tid01130  Biosynthesis of antibiotics
tid01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thein_0153
   00620 Pyruvate metabolism
    Thein_0153
   00640 Propanoate metabolism
    Thein_0153
  Energy metabolism
   00680 Methane metabolism
    Thein_0153
Enzymes [BR:tid01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Thein_0153
Lipid biosynthesis proteins [BR:tid01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Thein_0153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N Peptidase_C28
Motif
Other DBs
NCBI-ProteinID: AEH44038
UniProt: F8A8Y9
Position
156132..158039
Genome map
AA seq 635 aa AA seqDB search
MSNAHNYDTQIDHLLKSTERFSPPTKVLEEAFIKDYDSVYAYSIRDPEGFWGQIASELAW
FEPWQKVREINLPYHRWFVGGKTNITLNALDRHADSWRRNKVAVIWLSEEGEEQVGTYGQ
LRDRVNQFANGLKSLGVGKGDRVVIYMPLTIEGVIAMLACARIGAIHSVVYAGMGAGALR
SRIEDCQAKIVICSDVTFRRGKVVRLKAVVDEALETLDFVEKVIVHRRTSPPIELEEWEV
DFWELLKSHSHRCQAEVMDAEDPLFILYTSGTTGKPKGVVHVHGGYMVGTYYLSRAFFDL
KDQDVYWCTSDIGWIVGHSFIVYGPLCAGATILIREGAPDYPHPGVIWEMVQKYGVSVMF
TAPTALRMFMRFGKEHIEKYDRSTLRILACAGEPLNPEAWRFAQEIILENQGYCIDNFWQ
TEVAGPVLGTLPCLSAKPGFAGKPLPGVLADVVDAEGRSLPAGKGGYLVLRQPLPYMMRT
IYNDPARYESYWKEIPGCYKTGDIAVCDEEGYFAVLGRADDVLNVAGHRIGTADLESALV
SHPAIAEAAAIGLPDEVKGERIKVFVVLREGKKPSDGLRKSIIKHVRKELGPIATPSEVV
FVDKLPKTRSGKIMRRLLRARELGLPEGDTSTLED
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacgcccacaattatgacacacaaattgatcatcttctaaaaagtactgaaaga
ttttctccccctactaaagttttagaagaggcttttataaaagattacgactctgtttat
gcctactcaattagagatccagagggcttttgggggcaaattgcctcagagcttgcctgg
tttgaaccatggcaaaaggtaagagagataaatctaccctaccatcgctggtttgtaggc
ggaaaaacaaacatcaccttaaacgcccttgaccgccatgctgattcctggaggcgcaat
aaagtagccgtaatctggctttctgaagagggagaagaacaagtcggcacatacggccag
cttagagacagagttaaccagtttgctaatggactcaaatcattaggtgtcggcaaaggt
gatcgggtagtcatttacatgcctttaaccattgaaggtgttatcgctatgctagcctgt
gctcgtatcggggccattcactcggtagtttacgccggcatgggagccggagccctgcgt
tctcgtattgaagattgtcaggctaagattgtgatatgttctgacgtgactttcagacgt
ggcaaggtggtaagacttaaagccgtagttgacgaagcccttgaaacactagactttgtc
gaaaaagtaatagtccaccgtcgcacaagcccacccattgagctggaagaatgggaagtt
gacttctgggaacttttaaaaagtcattcccatcgttgccaagctgaagtcatggatgcc
gaagatccattatttatactttatacttcgggaacaaccgggaaacctaaaggcgtggtc
catgttcatggtggatatatggtaggcacttattatctttccagagcctttttcgattta
aaagaccaagatgtctattggtgcacatctgatataggctggatagtagggcattctttt
attgtttacggaccactctgtgccggggctactattctcattcgcgaaggagcccctgac
tatccccatccgggcgttatctgggagatggtacaaaaatacggtgtctccgtaatgttt
accgcccccaccgctctccgtatgtttatgcgctttggcaaggaacacattgaaaaatat
gataggtcaaccttaagaattctagcctgtgccggagaacccctgaatcctgaagcctgg
cgctttgctcaggaaataatccttgaaaatcaaggttattgtatagataatttctggcaa
actgaggtagctgggcctgttttaggtacccttccctgtctttcagctaaaccaggcttt
gcgggaaaacctttgcctggagtgctggctgacgtggttgatgccgagggacgttctctc
ccagcaggtaaaggcggatatctcgttctgagacaacctctgccttacatgatgcgcact
atttataatgacccggccagatatgaatcttactggaaagaaattcccggttgctacaaa
actggagatattgctgtttgcgatgaggaaggctatttcgccgtgttaggaagggcagac
gacgtactaaacgtagctggtcaccgtattgggacggcagaccttgaatcagccctggtt
agtcatccagccattgccgaagctgcggccattggacttccagatgaagtaaaaggggaa
cgcatcaaagtctttgtagttttgagagaagggaaaaagccctctgatggcttgagaaaa
agcatcatcaaacacgtacgcaaagaattagggcctattgctacaccttctgaggtggtt
tttgttgataaactcccaaaaacgagaagtggaaagataatgcgtcgcttattacgggct
cgagagttagggcttcctgaaggagatacctctacccttgaagattaa

DBGET integrated database retrieval system