KEGG   Thermodesulfatator indicus: Thein_0157Help
Entry
Thein_0157        CDS       T01546                                 

Definition
(GenBank) aminodeoxychorismate lyase
  KO
K07082  UPF0755 protein
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YceG
Motif
Other DBs
NCBI-ProteinID: AEH44042
UniProt: F8A8Z3
Position
complement(162130..163227)
Genome map
AA seq 365 aa AA seqDB search
MSKILSFLVISLVVLYVGAWYYELTLPVTTDKDTPSKIIFIEPGTPLKKIASLLEREGLI
KNKWIFIFETYRLGLTNQIKAGEYELSPREPLAKILETLVQGRVVTHYVTIPEGYNIYEI
ARLLDKAGLCSRNDFLQVVQDKEFLKKFNIPGDTAEGFLFPDTYAFWRGISCRLIVATMI
KRFWEVWNSEFAERAKELGLSVKEVVTLASIVEKEAVMPQERPIIASVFWNRLKRGMKLQ
SDPTVRYAVKRFYSRLRYRDLRYRDPYNTYIYPGLPPGPICNPGKASIKAVLYPAKTDYL
YFVSKGDGTHYFSRTLREHERAVDIYQRGIRPRKSLTTKKEKTLETQEKVLKSNNGTSED
TSSQK
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaattttatcttttttagtaatatccctagttgttctttatgttggcgcctgg
tattacgagctcactttgcccgtaaccacggataaagacactccttccaaaattattttt
attgaaccaggcacacctttaaaaaaaattgcttctcttttggaaagagaaggcctgata
aaaaacaaatggattttcatctttgaaacttaccgcctgggcctcaccaaccaaataaaa
gccggcgagtatgaactaagcccccgagagcctttagcaaaaattttagaaactctcgtc
cagggccgagttgttacccattatgtcactattcccgaaggctataatatctacgaaatt
gcccgtttactggataaagctggtctttgttctcgaaatgatttccttcaggtagttcaa
gacaaagaatttctcaagaagtttaacattccaggagatacggctgaaggttttcttttt
cccgatacttacgctttctggcgaggaataagctgccgtctcattgtggccacgatgata
aaacgcttttgggaagtctggaacagcgaatttgccgaacgggccaaagagctaggtctt
tcggtaaaagaagtagtcacccttgcctctatcgttgaaaaagaagccgttatgccgcag
gaaaggccaattattgctagtgttttctggaatcgtcttaagcgtggcatgaaacttcag
tcagaccctactgtgcggtatgcggtaaagcgtttttacagtcgtttgcgttaccgggat
ttgcgttaccgtgatccatacaatacttacatttatcctgggcttcctccaggtcctatc
tgtaatcctggaaaagcctctataaaagcggtgctctatcccgctaaaacagattatctt
tacttcgtttctaagggagacggaactcattatttttcccgaactttaagagaacacgag
cgagcagttgacatttaccagcggggtataaggccacgaaaatctctcacgacgaaaaaa
gaaaaaacccttgagacccaagaaaaagtgcttaaatcaaataatggaacttccgaggat
acttcgtctcaaaaatag

DBGET integrated database retrieval system