KEGG   Thermodesulfatator indicus: Thein_0164Help
Entry
Thein_0164        CDS       T01546                                 

Definition
(GenBank) hypothetical protein
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VCBS
Motif
Other DBs
NCBI-ProteinID: AEH44049
UniProt: F8A900
Position
complement(167819..169405)
Genome map
AA seq 528 aa AA seqDB search
MRKIFILLVGIFAFTKISLAAPSIDQLFKDFSPLSAKVIAQEGQFFLNVGTNKGLKVGEW
WLIYQQGEPIVDPDTGKILGYQEKPAARAQIIQVFPTYSVLKVFCLSPGCTISTGARAER
LAGVRAFFFDLTGKAFPIYERLRASYPKLKWQPYEKVTSRKAIPKGTQRVLFVAENNFLY
FYSDGHVLGVYTLSAQPAYQESRPLEKARPYQLIGRLREIVYHLDVLPLGQTIYVASLTK
RKIYLQRLKGREHFVYAYHGFGNLINFSVGPDGLIALNIFDGKRVKSRIIKFTGKNFVKV
TKDSPYILRFFDFNSDGIKETLIGQSFDSENFYGYGVFTFKIDGKDLKKEKSIKIPSGFR
IFGAFWTDLNLDKKLETGFYNEGRRLVIYQGKKRLWSSSVKFGAGIQYVFMDYPETSIKT
PKKIYIWPNPWVVKWQEWPRVLIPYNEFGLLGGIVSGAKRSTVGVLFYTREGYQLFFWRQ
SFQGSVQAVFSFKGNVYIAVVEGDLFKGEGETRIFKVSLAQLMRNLSY
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaatttttatcttgctggtgggtatttttgcctttaccaagatatctctggct
gctccatctatagatcaattattcaaagatttttctcctctttccgccaaagtcatagcc
caggaagggcagtttttcttaaatgttggtaccaacaaaggcttaaaggtaggagaatgg
tggttgatttatcaacaaggcgaaccgatagtcgatcctgatactggaaaaattctaggt
tatcaggaaaaaccagcggcccgagcccaaattattcaggtctttccaacctattcggta
ttaaaagttttttgcctttcgccaggttgtaccatatcaaccggggccagagctgaacgc
ctggcaggggttagggccttcttttttgatttaactggcaaggcttttcctatttacgag
agattaagggctagctatcccaagctaaaatggcagccttacgaaaaagtcacttctcgt
aaagctattcctaaagggactcaaagagtactttttgtggctgaaaataactttctctat
ttttatagcgatggccatgttctgggggtttacaccctttctgcgcaacccgcatatcag
gaatcaaggccattagaaaaagcacgtccttaccaattaatagggcgtttacgagagata
gtttatcacctagatgtgctacctcttggtcagaccatttatgtagcttctctcactaaa
cgaaagatttatttgcagcgtttgaaaggtcgcgaacactttgtttatgcctaccatggc
tttggtaatttaataaacttttccgttggtccagatggtttaatagctttaaacatattt
gacgggaaacgtgttaaatcccgaattataaaatttactggcaaaaattttgtcaaagtt
accaaagactcaccttatatcttgcgattttttgattttaattcggacggtattaaggaa
acgcttataggccagagttttgatagtgaaaatttttatggctacggagtctttactttc
aaaatagatggaaaagacttaaagaaagaaaaaagtataaaaataccttcgggttttaga
atattcggagccttttggactgatctcaatttggataagaaattagaaacaggtttttat
aatgaaggacgcagactagtaatctatcagggaaaaaagagactttggagttccagtgta
aaatttggtgcaggaattcaatatgtttttatggattatccagagacctcaataaaaact
cccaagaagatttatatctggcctaatccgtgggttgttaagtggcaggagtggccaaga
gttttgattccctataacgaatttggcctccttggaggcattgtttcaggagctaaacgt
tctacagtgggcgtgcttttttatactcgcgaaggttatcaactctttttctggcggcaa
agttttcagggtagtgtccaggcggtgtttagttttaaaggcaatgtttatatagctgta
gtagaaggagacctttttaaaggggaaggggaaaccagaatttttaaggtttcgttagcc
caattaatgcggaacctcagttattaa

DBGET integrated database retrieval system