KEGG   Thermodesulfatator indicus: Thein_0402Help
Entry
Thein_0402        CDS       T01546                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tid  Thermodesulfatator indicus
Pathway
tid00260  Glycine, serine and threonine metabolism
tid00750  Vitamin B6 metabolism
tid01100  Metabolic pathways
tid01110  Biosynthesis of secondary metabolites
tid01120  Microbial metabolism in diverse environments
tid01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thein_0402
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Thein_0402
Enzymes [BR:tid01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Thein_0402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AEH44284
UniProt: F8AAL2
Position
complement(423860..425251)
Genome map
AA seq 463 aa AA seqDB search
MRYISTRGGINPIPFKETVLMGLAEDGGLILPDNIPQVSANTLYLWRGLSYSELAFEVLS
LFADDIPGDDLKNLVEKAYSSFSHPEICPVVKKGDIWILELFHGPTLAFKDIALQFLGNL
FEYLLIERKQKMNILGATSGDTGSAAIYGVRGRQNINIFILFPKGRVSPIQELQMTTVPD
QNVFCLAIEGTFDDCQYIVKSIFNDLDFKKKYSLGAVNSINWARVLAQVVYYIWAYFRVI
ESEKVKEVRFSVPTGNFGDIFAGYLAKRIIGKGIERLVLATNENDILTRFVNKGDYSLGQ
VTSTISPSMDIQIASNFERYLYYLLNEEPSRVREAMEHFSQTGKLAFSAEEIAKVKKDFL
SASISQKETLAMIASFYEKTGYVLDPHTAVGVAAGFKFKDERPMIALATAHPAKFPEAVK
QAIGREPEKPESLKGLEEKPKRVKVLPAKIEKVKEFVAQNALI
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgcgatacataagtactaggggtggtataaaccctattccttttaaagaaacggtttta
atggggcttgctgaagatggtgggctaattttaccagataatatccctcaagtatcagct
aataccctgtatttatggcgtggcctttcatattcagaactggctttcgaggtgttaagc
ctttttgccgatgatatacctggtgatgatttaaaaaacttggttgaaaaggcctattct
tctttttctcatcctgaaatttgtccggtggtaaaaaaaggtgatatttggatacttgaa
ctttttcacgggccaactcttgcttttaaagatattgctctacaatttttgggcaatctc
tttgagtatttacttattgaacgtaaacaaaagatgaatatcttgggagctacttctgga
gatactggctcggcggctatttatggagttagggggcgccagaatataaatattttcatt
ttgtttcctaaaggacgtgtttcacctatacaagaattgcagatgactacggtgccagat
caaaatgttttttgcctggctattgagggcacttttgatgattgtcagtatattgtcaaa
agtatttttaatgatcttgatttcaaaaagaaatattctctcggagctgttaactctata
aactgggctagggttttggctcaagttgtttattatatttgggcctattttagggtcatt
gaaagcgaaaaagtgaaggaagttagattttctgttcctacagggaactttggtgatatt
tttgcagggtatctcgccaaacgcataataggcaaaggtatagaacgcttggttttagcc
actaatgaaaacgatattttgacccgctttgtgaataagggagattattctcttggccag
gtaacttctaccatcagcccttccatggatattcagattgccagtaattttgaacgctat
ctttattatcttttaaatgaagaaccatctcgcgtgcgcgaagccatggaacatttttct
caaacaggcaaattggctttttctgcagaagaaattgccaaggtaaaaaaagatttcctt
tcagcctctattagtcaaaaagaaaccttggcaatgattgcttctttttatgaaaaaact
ggctacgtactcgaccctcacacggctgttggggtagcggcaggttttaaatttaaagac
gaacgaccaatgatagccttggccacggcccatcctgctaaattccctgaggctgtaaaa
caagctatagggcgtgaacccgaaaagcctgaatctctcaaagggctcgaagaaaagcct
aagcgggttaaagttttacctgcgaagattgaaaaagtaaaagaatttgtagcccaaaat
gctttaatttaa

DBGET integrated database retrieval system