KEGG   Thermodesulfatator indicus: Thein_1121Help
Entry
Thein_1121        CDS       T01546                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tid  Thermodesulfatator indicus
Pathway
tid00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tid01100  Metabolic pathways
tid01110  Biosynthesis of secondary metabolites
tid01130  Biosynthesis of antibiotics
tid01230  Biosynthesis of amino acids
Module
tid_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thein_1121
Enzymes [BR:tid01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Thein_1121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AEH44992
UniProt: F8AE21
Position
complement(1190009..1190782)
Genome map
AA seq 257 aa AA seqDB search
MKNILEKILLTKQKEVLARKERGLFFRPFWDYPRKSLEKALKTQDFAIIAEIKKASPSKG
LIAREFHPKKIAEEYENAGAAAISCLTDEPFFHGHLEFLAAVREVTKLPLLRKDFIIDEI
QIEEARAFGADAVLLIVAALSPEKLNSLLEKTYELGLEALVEVHDEKELEIAIEVGAKII
GINNRNLKTFEVKIETSLALAAKVSEEIILVSESGIKDHADICLLKAAGIKAALIGETLM
RAKDKEATLYQLLKGQK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacattttagaaaagattttgctcaccaaacaaaaagaagtgttagctcgtaaa
gagagggggttattttttcgtcctttctgggactatccacgaaaatctctagagaaagcc
cttaaaactcaagactttgctattatcgctgaaatcaagaaggcctctccttcaaaaggt
ctcattgcccgagagtttcatcctaaaaaaatcgctgaggaatacgaaaatgctggggct
gctgccatttcttgcctgacagatgaacctttttttcatggacatctggaattcctcgcc
gctgtacgagaagtgaccaaacttcctcttttgcggaaagacttcattattgacgaaatc
caaattgaagaagctcgagcctttggagctgatgctgtgcttttaattgtagccgccctt
tctccagaaaaacttaatagtttactagaaaagacctacgaattagggcttgaagccctg
gttgaagtacacgatgaaaaagaattggaaatagccattgaagttggagctaaaataatc
ggaataaataaccgtaatcttaaaacctttgaagtaaaaattgagacttctttggcgttg
gcggctaaggtatctgaagaaattattttggtttcagaatcagggattaaagatcacgca
gacatttgtctcttaaaagcagcgggaatcaaagccgctttaataggagaaactttaatg
cgagccaaagacaaagaagctacactctatcaacttcttaaaggccaaaaataa

DBGET integrated database retrieval system