KEGG   Thermodesulfatator indicus: Thein_1300Help
Entry
Thein_1300        CDS       T01546                                 

Definition
(GenBank) argininosuccinate lyase
  KO
K01755  argininosuccinate lyase [EC:4.3.2.1]
Organism
tid  Thermodesulfatator indicus
Pathway
tid00220  Arginine biosynthesis
tid00250  Alanine, aspartate and glutamate metabolism
tid01100  Metabolic pathways
tid01110  Biosynthesis of secondary metabolites
tid01130  Biosynthesis of antibiotics
tid01230  Biosynthesis of amino acids
Module
tid_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Thein_1300
   00220 Arginine biosynthesis
    Thein_1300
Enzymes [BR:tid01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     Thein_1300
Exosome [BR:tid04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Thein_1300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 ASL_C2
Motif
Other DBs
NCBI-ProteinID: AEH45167
UniProt: F8A939
Position
1364280..1365659
Genome map
AA seq 459 aa AA seqDB search
MAQKPWGGRFSEETDKLVEEFTASVHYDKRLALYDIRGSIAHARMLGKTGIIPLEDAEKI
IAGLKEIEKDIKEGRFKWRKDLEDVHMNIEAALYEKIGPVAGKLHTARSRNDQVATDVRL
FLRDVIDETLSRLKDLRKALVEKAKENLEVILPGFTHLQHAQPVLLAHHLMAYYEMFTRD
AKRFAFVRQETNVCPLGSAALAGTPFPVDREMVAQELGFAGITRNSMDAVSDRDFIVSFL
AAASLAFVHLSRLSEELILWISQEFGFIDLPDKLCTGSSIMPQKKNPDVAELIRGKSGRV
FGNLFTLLTVLKGLPMTYNRDLQEDKEPLFDTVDTLLAVLALAKELIVGLKVNRERMRKA
CEEGHLTATDLADYLVTKGLPFREAHHVVGRLVAYCEEKGQKLWELPIEKLKEFSELIGE
DVYEWLTLEGSVSRRKVVGGTAPEQVEKAIYQAEKELEA
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggcccaaaagccctggggaggacgtttttccgaagaaacagataaactggtagaggag
ttcaccgcctcggttcactacgataaaagacttgccctttacgacattcgcggaagcata
gctcacgcccgcatgctgggaaaaacgggcattattcccttagaagacgccgaaaaaata
atagctggtcttaaagaaattgaaaaagacataaaagaaggccgttttaagtggcgcaaa
gatttagaagacgtgcacatgaacatagaggccgccctttacgaaaagattggcccggtg
gcgggaaagcttcacaccgcccgcagccggaacgaccaggtggccacagacgtaaggctt
tttctgcgagacgttatagacgaaaccttaagccgcttaaaagacttgagaaaagccctg
gtagaaaaggccaaagagaacctggaagtaattcttcccggtttcacccatctccaacac
gcccagccggtacttctggcccaccaccttatggcttattacgagatgtttacccgtgat
gccaaacgttttgcctttgtccgccaggagacaaacgtttgtccgttgggaagtgccgcc
cttgcaggaacaccctttcctgtggatcgtgagatggtggcccaggaacttggctttgca
ggcattaccagaaacagtatggacgccgtttctgatagggactttatcgtctccttcctt
gcggccgcgtctctcgcttttgttcatctttcgcgcctttcagaagaactaattctctgg
ataagccaggagttcggttttatagacctgccggataaactttgcaccggtagctctatt
atgccccagaaaaaaaatcccgacgtggcggagctcatcagaggaaaaagcggccgcgtt
tttggaaatctcttcactcttttaacggtgttaaaaggccttccaatgacctataaccgt
gacctccaggaagacaaagagcctctttttgatacggtagatacccttttggcggtcctg
gctctggccaaagaattgatagtgggccttaaagtgaaccgggagcgcatgcgcaaggcc
tgcgaggaagggcatctcacggctacagatctggctgattacctggttactaaagggcta
ccctttcgcgaggcccaccacgtggtaggccgtctggtggcctattgtgaagaaaagggc
caaaagctctgggagttgccaattgaaaagctaaaagagttttccgagctaatcggagaa
gatgtttatgagtggcttacccttgaaggttcggtgtccaggcgtaaagtagtggggggc
acggccccagagcaagtggaaaaagccatttatcaggcggaaaaagaactggaggcttaa

DBGET integrated database retrieval system